GenomeNet

>sp:DNAA_BURCJ [B4E7D1] RecName: Full=Chromosomal replication initiator protein DnaA {ECO:0000255|HAMAP-Rule:MF_00377};
MNDFWQHCSALLERELTPQQYVTWIKPLAPVAFDASANTLSIAAPNRFKLDWVKSQFSGR
IADLAREFWNTPIEVQFVLDPKAGMRSAPAGAAPAAPRAPLAPNGPAATVAAIAANLTAN
ASAAPAAPADVPMTPSAAAARHLNADDADIDLPSLPAHEAAAGRRTWRPGPGAAPANGGE
ADSMYERSKLNPVLTFDNFVTGKANQLARAAAIQVADNPGISYNPLFLYGGVGLGKTHLI
HAIGNQLLLDKAGARIRYIHAEQYVSDVVKAYQRKAFDDFKRYYHSLDLLLIDDIQFFSG
KSRTQEEFFYAFEALVANKAQVIITSDTYPKEISGIDDRLISRFDSGLTVAIEPPELEMR
VAILMRKAQSEGVNLSEDVAFFVAKHLRSNVRELEGALRKILAYSKFHGREISIELTKEA
LKDLLTVQNRQISVENIQKTVADFYNIKVADMYSKKRPANIARPRQIAMYLAKELTQKSL
PEIGELFGGRDHTTVLHAVRKIADERSKDAQLNHELHVLEQTLKG

BLAST