GenomeNet

>tr:B8D6B6_DESA1 [B8D6B6] RecName: Full=Probable Brix domain-containing ribosomal biogenesis protein {ECO:0000256|HAMAP-Rule:MF_00699};
MILITTSHRPSQRVRSFAKDLSSVIPYSIRVTRGKKTLEDLVIEAYKNGLSYIAIIGERR
GNPSTIEIYKVDSSIMPPSAIRISTLLLSGVRLSRENPESIRVYNPRSVKVEYDQCVTDE
CFALADILLSITSKAFSRQPDVKIALEESEYVDVEFYSSTNHRIGPSLRIARVILYK

BLAST