GenomeNet

>tr:B8HU35_CYAP4 [B8HU35] SubName: Full=Ion transport 2 domain protein {ECO:0000313|EMBL:ACL42955.1};
MVQSVENSPTPKGLRQRVAFYLEDTQTPLAIAIDLLITALVLISLAIFVVDTYPLPSPIR
VSLKTINDSILVIFAIEYGLRLWAAENRLRYCLSLYSVIDLLTILPFFVGAVNISFIRIF
RWFRILRLLRFFKGRSFFGLINTTDGIIFVRIVFTLIAIVFVYSGLIYQAEHDVNPQNFR
TFLDAFYFAVVTMTTVGFGDVTPTSDLGRLLTVMMIFTGIALIPWQVGDLIRQLVKTNRS
EVKSLCPTCRLAQHDQDAQFCKVCGTKLKTLSMLEQ

BLAST