GenomeNet

>tr:C3YLF6_BRAFL [C3YLF6] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EEN58893.1};
MPVGKSLEDGKFSAALESSEGGYAKVKITTPPDAIVGKYHVVIETMSDGKTFRSRKTDDN
TVVVLFNPWVKEDMTYLDDDAQLGEYVLNEHGYQYYGTSLRIGKRPWNFGQFEPKILDVC
LRLLDRSKIKAESRGDAVKVSRIVSKMVNSADDGGVLTGNWSGNYAGGRSPTAWNGSVEI
LRQYYERNRPVCYGQCWVFSGVMTTVLRCLGIPARSVTNYDSAHDTDVSMTIDNYMDHNL
REIDGGDSVWNFHVWNEAWMARPDLPEGYGGWQAVDATPQETSDGVYCCGPCPISAVKNG
HVYLPYDTKFVFAEVNADKVYWLVRQHKNLRKLRTRKAAIGNKMSTKAVGSNARHDLTEN
YKYPEGSDQERVAVRTAVSHGLKPNTYDDVIEDEDVEFDVHADDEIYIGQNIHVTLSMKN
TSSEPRKVTTHLTARAMYYTGVPAHDIGEMEKDVTIPPNGEESVEMTYTPREYLDMLVDQ
AIVKIHAMAHVDDTNQVYSGQDDFRLMSPDLTVTAPTKMTLGEQVTAEIEFTNPLDVTLS
MVEFHIEGPGLQKPKKISHTPIKPGETVKVTERMTPRKVGKKTIMASFTSNKLTQVTGEV
DVVVS

BLAST