GenomeNet

>tr:C3ZM81_BRAFL [C3ZM81] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EEN46337.1};
MQARLTAASTQLNDGGEEAREFPEKDDSKLKSLGNALRTGWSRQSSRTRRSKPPAGVTGL
LPQIVTHGLTDPGRADRRVRINISGMKFDTRERVLLRYPQTLLGDVVRRQRFYVPEEEEY
FFDRHRPSFEGIFRYYQTGKIERPRNVPQDVFAAELAYFDMGKLVINKFLKDEGYDVSEN
VLPEKEPQRTVWILFESHDGILAKFVGLITVLFILLSVGTSCAETLPRFRNLTDQTFAHA
GDVKANLNIAFSNIFFQIETACIVWFCIELAMRFYASPRKRRFVKDIMNILDFVVILPYF
VDLILIVANVDPTGSNIIPATIVRVLRLVRVFRIFKLSRHMRALQMLAATLRASAPQLIM
LVFFMAILVVLYSSIIYFMEMDHPDHFFPSIPAAFWWAIITLTTVGYGDIYPKTPWGKAF
ACICVISGILVIAMPMPIITKNFEKFYKKNGNNPFKALPLNNGHEERDDNSSEHRKRTYA
VRLTDIETEEHESFLKDEDESSSGFLSSV

BLAST