GenomeNet

>tr:D1B9Y3_THEAS [D1B9Y3] RecName: Full=V-type ATP synthase subunit I {ECO:0000256|RuleBase:RU361189};
MVEMGKYRLAVHADAAEAVFREIQRFGFCEWILPEEEGSTPGFDSRELREIEDGLGDAKF
VLRFMDPLATQKPGGLDKALGRSPELSLELLEREAESRNFPKTAETIRGLERRLAEIRVE
ESRLKGILSQLLPLEGLDMPLSMFNQGTSMIEGHLGTIGEEAFFAFSEALQNRMGGSHEV
FRLGSSGDGQVVCAVIVLRSQLQEFKAVAEDFGFSKMEIPKDLAATPSQEVAKIRARLHQ
LEAEASSLVDEARKISDKAFADALVVSDHLSIVRSRKEVILRCSSTDSTKIGEFWMPVEK
EDALRKVLAPFESLVDLSRVPMEEDDVPPTLLSNPGWAASCEPLTLMYGVPTYGGVDPTA
MMAPFFFLFFGMCFGDAGYGLILTGLFSYMLVKHRLSSNLRKFFQVLAIGNGATILVGAI
TGSWFGNMVDAFPFLSAAKPMKDALQFLDPMKDPITFLGISLGIGFLQLIFGLFISMMDS
LRKGDYFGALADKASWIVLLVGLVSWAFGGALSGAVATVGKVMSAVGALVLVTTQGRDRK
NIISRAVIGLLSLYNVTAYLGDTLSYSRLLALGLSSAAIGMIVNLLCTLVVGVPYVGWLL
ALLIFVGGHLFSVAANILGAFIHSLRLQYVEFFSKFYEANGRAFSPFSCSTGYVRLSDTN
EPA

BLAST