GenomeNet

>tr:D2HJ10_AILME [D2HJ10] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EFB13967.1}; Flags: Fragment;
MSRRAALRQLLLVLQLAMLPTATPGREVVLGKAGDTAELPCHGSSGKNEGFSWKHSSTLK
ILEYGRSFPVRGASRLKHRVETKQNLWDQGSYPLIIKDLEVADSGVYFCEVAGKTREVEL
LVFDVTAKWDTGRSSSSNIRLLQGQRLTLTVEGPSGSSPSVQWKGPGNKSKGSGQSLSLS
GLELQDSGTWTCTISQNQETAVFHINILVLAFQKVSNTVYTKEGDQVEFSFPLSFEDENL
SGELRWQAEGAPSSLLWSSFVLENRKLSVKELHVPKLQLKESLPLSFILSQASSRYAGSG
TLTLSLAKGTLQREVNLVVMRVTKSKNNLTCEVLGPTSPELTLSLNLEEQAAKISKRQKL
VLVMDPEGGTWQCLLSDKDKVLLASKIEGVVPT

BLAST