GenomeNet

>tr:D5SUK3_PLAL2 [D5SUK3] SubName: Full=Restriction modification system DNA specificity domain protein {ECO:0000313|EMBL:ADG67055.1};
MNMPPNGWTTDALSNLVTFKTGKLNSNAAVSNGAYPFFTCSQETLRTNTFAFDTECVLLA
GNNANGIYPLKYFHGRFDAYQRTYVVTPQDCTRLNTRFLYYSMWPLLEHLQSISTGAATK
FLTLTILNGLQLTFPSEPVQRKIAGILSAYDDLIENNTRRIAILEEMAQAIYREWFVHFR
FPGHENTLLVDSPLGKIPEGWQVKRLDSICERITSGGTPRTNVNEYWDGDIPWLSSGETG
NTFITETEKKITQEGVTNSSTRFARSGCTVIASAGQGKTRGQTSMLCLDCYINQSTIAVT
ADGKQTTDSFLFFDLVQRYDQFRQISDGSSRGSLTTKLIADLEIILPQPFLIQKFDVLTT
PVVKHIENILRKNKILRKTRDLLLPKLISGELDVESLEIDFDEPTFQQPEVEKVIQPPKP
QIVSSPTAETGTPYKDDAAILCLLLQELLHLAPDRPNNEFVIQKHMFGLKHLRRHAINSK
FVAQKAGPWSQELRHKAVFAAAGFDWLRFDNQGKILLPGRKFTKGVEYAKSLLGEKAALV
TEFVQDLSKFGKSGLGKWMTIFKVVCDLHDAGQPITRQNIQTGIDNWPGKRDKNNFSVEN
VDDTISKMVRQKWFTLQAGS

BLAST