GenomeNet

>tr:E7GSL2_CLOSY [E7GSL2] RecName: Full=V-type ATP synthase subunit I {ECO:0000256|RuleBase:RU361189};
MIEKMKFLSITGPKEDIDRVVNLYLSKYEIQIENALSELKTVKDLRPYIEINPYKELFTR
AARLANSFNASETSRDKDTSAGRNKSIRILAGGDISIEEASETVQRVDKELADYRDSKGK
LEEELDTLRTSYNKIVPFRELDYDIRSILHFQHIRFRFGRIPREYYAKFEKVVYESLDTI
LYKCHEDEHYVSIVYFVPAVISKRIDAIYTSLHFERFIVPDEYNGTPGEAIDALEQQIKK
AEAALESTNSEISRILEENRRDILAAYEKLNSYNTNFNVRKLAACTNHDVNTFYILCGWM
TETDAANFKKELETDDKTFCIVEDDHNNLLTPPPTKLRNPKLFRPFEMFIKMYGLPAYGE
FDPTILIGITYSFLFGFMFGDVGQGLLLLLGGYLLYRVKKMDLAAVISCCGFFSAVFGFL
FGSVFGFEDVIHPLWLRPAAQMMNLPFIGKLNTVFIVAVALGMGIIVLTMILNIVNSVRF
HDPEKSWFDANGLAGLVFYGSVLAVVVLFMMGKTLPAAWVLAVMFGIPLVIIFLKEPLAS
LVKKQAGKHSDSRVMFFVQGFFEMFEMLLSYFSNTLSFVRVGAFAVSHAAMMEVVMMLAG
AESGSLNWAVVIIGNLFVCAMEGLIVGIQVLRLEYYEIFSRFYKGSGREFKPYGKA

BLAST