GenomeNet

>tr:E7QFN4_YEASZ [E7QFN4] SubName: Full=YHR113W-like protein {ECO:0000313|EMBL:EGA86500.1};
MHGLTLAADTEIDRESGIRLMACFDHEEIGSSSAQGADSNFLPNILERLSILKGDGSDQT
KPLFHSAILETSAKSFFLSSDVAHAVHPNYANKYESQHKPLLGGGPVIKINANQRYMTNS
PGLVLVKRLAEAAKVPLQLFVVANDSPCGSTIGPILASKTGIRTLDLGNPVLSMHSIRET
GGSADLEFQIKLFKEFFERYTSIESEIVV

BLAST