GenomeNet

>tr:F1M6X3_RAT [F1M6X3] SubName: Full=Potassium voltage-gated channel subfamily KQT member 2 {ECO:0000313|Ensembl:ENSRNOP00000040830}; SubName: Full=Potassium voltage-gated channel, subfamily Q, member 2, isoform CRA_d {ECO:0000313|EMBL:EDL88762.1};
MVQKSRNGGVYPGTSGEKKLKVGFVGLDPGAPDSTRDGALLIAGSEAPKRGSVLSKPRTG
GAGAGKPPKRNAFYRKLQNFLYNVLERPRGWAFIYHAYVFLLVFSCLVLSVFSTIKEYEK
SSEGALYILEIVTIVVFGVEYFVRIWAAGCCCRYRGWRGRLKFARKPFCVIDIMVLIASI
AVLAAGSQGNVFATSALRSLRFLQILRMIRMDRRGGTWKLLGSVVYAHSKELVTAWYIGF
LCLILASFLVYLAEKGENDHFDTYADALWWGLITLTTIGYGDKYPQTWNGRLLAATFTLI
GVSFFALPAGILGSGFALKVQEQHRQKHFEKRRNPAAGLIQSAWRFYATNLSRTDLHSTW
QYYERTVTVPMYSSQTQTYGASRLIPPLNQLELLRNLKSKSGLTFRKEPQPEPSPSQKVS
LKDRVFSSPRGVAAKGKGSPQAQTVRRSPSADQSLDDSPSKVPKSWSFGDRSRARQAFRI
KGAASRQNSEEASLPGEDIVEDNKSCNCEFVTEDLTPGLKVSIRAVCVMRFLVSKRKFKE
SLRPYDVMDVIEQYSAGHLDMLSRIKSLQSRVDQIVGRGPTITDKDRTKGPAETELPEDP
SMMGRLGKVEKQVLSMEKKLDFLVSIYTQRMGIPPAETEAYFGAKEPEPAPPYHSPEDSR
DHADKHGCIIKIVRSTSSTGQRNYAAPPVMPPAQCPPSTSWQQSHQRHGTSPVGDHGSLV
RIPPPPAHERSLSAYSGGNRASTEFLRLEGTPACRPSEAALRDSDTSISIPSVDHEELER
SFSGFSISQSKENLDALASCYAAVAPCAKVRPYIAEGESDTDSDLCTPCGPPPRSATGEG
PFGDVAWAGPRK

BLAST