GenomeNet

>tr:F5HLG5_ANOGA [F5HLG5] RecName: Full=V-type proton ATPase subunit a {ECO:0000256|RuleBase:RU361189};
MGSLFRSEEMSLCQLFLQSEAAYACVSELGELGLVQFRDLNPDVNAFQRKFVNEVRRCDE
MERKLRYLEKEIKKDGIPMLDTGESPEAPQPREMIDLEATFEKLENELREVNQNAEALKR
NYLELTELKHILRKTQVFFDEMADSHREEEQVNLLGEEGIRAGGAGAQGQNLKLGFVAGV
ILRERLPAFERMLWRACRGNVFLRQAMIEDPLEDPSNGDKVYKSVFIIFFQGDQLKTRVK
KICEGFRATLYPCPEAPTDRREMAMGVMTRIEDLHTVLGQTQDHRHRVLVAAAKNLKNWF
VKVRKIKAIYHTLNLFNLDVTQKCLIAECWVPLLDFETIQIALRRGTERSGSSVPPILNR
METFEDPPTYNRTNKFTHAFQALINAYGVASYREMNPAPYTIITFPFLFAVMFGDLGHGT
IMALFGLWMVLKEKPLAAKKSDNEIWNIFFGGRYIIFLMGVFSMYTGFVYNDIFSKSLNV
FGSAWSTNYNTSTVMSNKALQLNPKGMDYAQTPYPFGLDPVWQVAPLNKIIFQNAYKMKI
SIIFGVIHMLFGVFVGLFNHRYFKNKMAIYCEFIPQVIFLVFLFFYMTLLMFIKWVKYSA
SATDVVYSEGCAPSILITFINMVLFKAPDEHTGDCSPYMFAGQSGLQKFLVVVALLCVPW
MLLAKPILIMRGRKEAAVSVFIETLDDSGTQAGQQPAQQQGGGHGHDNEEMSEIFIHQGI
HTIEYVLGSVSHTASYLRLWALSLAHAQLAEVLWNMVLQNGLKQDGWIGGIALWAVFAFW
AVLTVGILVLMEGLSAFLHTLRLHWVEFQSKFYAGLGYAFQPFSFEVILESSSSSSED

BLAST