GenomeNet

>tr:F6GEQ2_LACS5 [F6GEQ2] SubName: Full=Cleaved adhesin domain protein {ECO:0000313|EMBL:AEH00612.1};
MKKITFLLLLATVSFSANLFGQQKTPIQNTKRSIQQQIPAFEPTKETQNSLEQTGYARCL
TDENEIALQKQYPSRVNSAEFEAWIAPKLAQYKADRAAGKTMPPVFNIPVVIHIIHNGDP
INTNGLPGNENISDAQALSQIQVMNEDYRRLANTPGGANTTGLAQDIEINFCIAQQDPFG
SPTTGIVRHNITPPSNTSAATDDWETRADTENMKTTTQWDPEMYLNMWTIKAGGLPINQG
GQQGLLGYAQFPSNSGLAGINTNGGAANTDGVVASYDAMGTLAENDGSFILNNQYNLGRT
MTHEVGHWLGLRHIWGDGDCSADDFCADTPISGNPNYTCNLSADSCPTSAGNDQVQNYMD
YTNDACMDTFTQDQKDRMVIVMQNSPRRMQLNTSNTCSPASPTVNYTTTAPNSVIEGSDC
GFQDFTFQLSISSPTTATTTANLISTGSATINEDFDLLNNSVVFNAGTGFPSGNDTITLR
VYNDSFVETDEDITLEVNVTTTGDAIASTTPFTLTLVNDDIAATGSANTTIFTQDWEDTT
GWTIIDSDGDGENWGVFQPLTFGNLSGNWAGSVTDQSVVGGTGVLTPDNYIISPAITIGS
SATSVEFNYEIGAAGTPEHFAVYFTTDITDESTIIAGTLLEETNTIGGTTENRSVITSDS
NIVGQTGHLVFRHFNTTGNSLIMLDTINIIESINFVVQTEENIANPSTINVNTTGTAYSF
DNATGNIVAGLDNTGGFDYGCTTITVTRDQTIAGAPTVLRPGSTANEDRVMAKTISFTPE
NTNTSGQTTLSFYFTNAEITAWETITGESRNNLFAFREGTNVSEPVTVSDFNGDYILTVP
FTSGIDGNYYFGRQFNLSTPSFDLENSVSIFPNPTRNSLTISSKNNEIPSEYSVYNMLGQ
LITNKKINTEADLTLNTSALSNGVYFIKIAKDNAAITLRFIKE

BLAST