GenomeNet

>tr:F6YWY4_HORSE [F6YWY4] RecName: Full=Voltage-dependent T-type calcium channel subunit alpha {ECO:0000256|RuleBase:RU003808};
GREEDGAGAEESGQPRSFMRLNDLSGAGGRPGPGSAEKDPGSADSEAEGLPYPALAPVVF
FYLSQDSRPRSWCLRTVCNPYPPGRISMLVILLNCVTLGMFRPCEDIACDSQRCRILQAF
DDFIFAFFAVEMVVKMVALGIFGKKCYLGDTWNRLDFFIVIAGMLEYSLDLQNVSFSAVR
TVRVLRPLRAINRVPSMRILVTLLLDTLPMLGNVLLLCFFVFFIFGIVGVQLWAGLLRNR
CFLPENFTLPLSVDLERYYQTENEDENPFICSQPRENGMRSCRSVPTLRGEGGGGPPCGL
DYEAYNSSSNTTCVNWNQYYTNCSAGEHNPFKGAINFDNIGYAWIAIFQVITLEGWVDIM
YFVMDAHSFYNFIYFILLIIVGSFFMINLCLVVIATQFSETKQRESQLMREQRVRFLSNA
STLASFSEPGSCYEELLKYLVYILRKAARRLAQVSRAAGVRAGLLSSPAPRGGPEPQPSG
SCSRSHRRPSVHHLVHHHHHHHHHYHLGNGTLRAPRASPEIQDRDANGSRRLMLPPPSTP
ALSGGPPGGTESVHSFYHADCHLEPVRCQAPPPRSPSEASGRTVGSGKVYPTVHTSPPPE
MLKDKALVEVAPTSGPPTLTSLNIPPGPYSSMHKLLETHSTGTCQRSCKISSPCLKADSG
ACGPDSCPYCARAGAGEVELAGHEMPDSDSEAVYEFTQEAQHGDLRDPHSRRRRNLGLDV
EPNSVLAFWRLICDTFRKIVDSKYFGRGIMIAILVNTLSMGIEYHEQPEELTNALEISNI
VFTSLFALEMLLKLLVYGPFGYIKNPYNIFDGVIVVISVWEIVGQQGGGLSVLRTFRLMR
VLKLVRFLPALQRQLVVLMKTMDNVATFCMLLMLFIFIFSILGMHLFGCKFASERDGDTL
PDRKNFDSLLWAIVTVFQILTQEDWNKVLYNGMASTSSWAALYFIALMTFGNYVLFNLLV
AILVEGFQAEEISKREDASGQLSCIQLPVDSQGGDATKSESEPDFFSPSLDGNGDRKKHL
ALVSLGEHLELPRSLLPPLIIHTAATPMSLPKSSSTGLAEALGPASRRTSSSGSGEPGTA
QEMKSPPSARSSPHSPWSAASSWTSRRSSRNSLGRASSLKRRSPSGERRSLLSGEGRESQ
DEEDSSEEEQASPAGGHCRHGGSLEREAKSSFDLPDTLQVPGLHRTATGRSTASEHQDCN
GKSAPGRLARALLPDDPPLDGDDGDDEGNLSKAERLRAWIRARLPACCRERDSWSAYIFP
PQSRFRLLCHRIITHKMFDHVVLVIIFLNCITIAMERPKIDPHSAERIFLTLSNYIFTAV
FLAEMTVKVVALGWCFGEQAYLRSSWNVLDGLLVLISIIDILVSMVSDSGTKILGMLRVL
RLLRTLRPLRVISRAQGLKLVVETLMSSLKPIGNIVVICCAFFIIFGILGVQLFKGKFFV
CQGEDTRNITNKSDCAEASYRWVRHKYNFDNLGQALMSLFVLASKDGWVDIMYDGLDAVG
VDQQPIMNHNPWMLLYFISFLLIVAFFVLNMFVGVVVENFHKCRQHQEEEEARRREEKRL
RRLEKKRRNLMLDDVIASGSSASAAPEAQCKPYYSDYSRFRLLVHHLCTSHYLDLFITGV
IGLNVITMAMEHYRQPQVLDEALKVCNYVFTVIFVLESVLKLVAFGFRRFFQDRWNQLDL
AIVLLSIMGITLEEIEVNASLPINPTIIRIMRVLRIARVLKLLKMAVGMRALLDTVMQAL
PQVGNLGLLFMLLFFIFAALGVELFGDLECDETHPCEGLGRHAFRNFGMAFLTLFRVSTG
DNWNGIMKDTLRDCDQESTCYNTVISPIYFVSFVLTAQFVLVNVVIAVLMKHLEESNKEA
KEEAELEAELELEMKTLSPQPHSPLGSPFFWPGGPESPDSPKSGALHATAHAGAASRLSL
EHSTDRQLFDTISLLIQGSLEGELKLMDELAGPGGQPSAFPPARSPGGSDPQIPLAEMEA
LSLTSEIVSEPSCSLALTDDSLPDDTHTLLLSAPESNMERHPEEVPLSMGPDLLTVRKSG
VSRTHSLPNDSYMCRDGSTAKGSLGHRGWGLPKAQSGSVLSVHSQPADTSYILQVPKDAP
HLLQPHSTPTWGTIPKLPPPGRSPLAQRPLRRQAAIRTDSLDVQGLGSREDLLSEVSGPS
PLARAPLFWGRLST

BLAST