GenomeNet

>tr:F7ETU0_MACMU [F7ETU0] RecName: Full=Voltage-dependent P/Q-type calcium channel subunit alpha {ECO:0000256|RuleBase:RU003808};
MARFGDEMPARYGGGGSGAAAGVVVGAGGGRGAGGSRQGGQPGAQRMYKQSMAQRARTMA
LYNPIPVRQNCLTVNRSLFLFSEDNVVRKYAKKITEWPYPFARTPAAAQHLPDDDKTPMS
ERLDDTEPYFIGIFCFEAGIKIIALGFAFHKGSYLRNGWNVMDFVVVLTGILATVGTEFD
LRTLRAVRVLRPLKLVSGIPSLQVVLKSIMKAMIPLLQIGLLLFFAILIFAIIGLEFYMG
KFHTTCFEEGTDDIQGESPAPCGTEEPARTCPNGTKCQPYWEGPNNGITQFDNILFAVLT
VFQCITMEGWTDLLYNSNDASGNTWNWLYFIPLIIIGSFFMLNLVLGVLSGEFAKERERV
ENRRAFLKLRRQQQIERELNGYMEWISKAGEALSSRALRRATIKKSKTDLLNPEEAEDQL
ADIASVGSPFARASIKSAKLENSTFFHKKERRMRFYIRRMVKTQAFYWTVLSLVALNTLC
VAIVHYNQPEWLSDFLYYAEFIFLGLFMSEMFIKMYGLGTRPYFHSSFNCFDCGVIIGSI
FEVIWAVIKPGTSFGISVLRALRLLRIFKVTKYWASLRNLVVSLLNSMKSIISLLFLLFL
FIVVFALLGMQLFGGQFNFDEGTPPTNFDTFPAAIMTVFQILTGEDWNEVMYDGIKSQGG
VQGGMVFSIYFIVLTLFGNYTLLNVFLAIAVDNLANAQELTKVEGDEQEEEEAANQKLAL
QKAKEVAEVSPLSAANMSIAMKEQQKNQKPAKSVWEQRTSEMRKQNLLASREALYNEMDP
DERWKAAYTRHLRPDMKTHLDRPLVVDPQENRNNNTNKSRAAEPTVDQRLGQQRAEDFLR
KQARYHDRARDPSGSAGLDARRPWAGSQEAELSREGPYGRESDHHAREGSLEQPGFWEGE
AERGKAGDPHRRHVHRQGGSRESRSGSPRTGADGEPRRHRGHRRPGEEGPEDKAERRARH
REGSRPARGGEGEGEGPDGGERRRRHRHGAPATYEGDPRREDKERRHRRRKENQGSGVPV
SGPNLSTTRPIQQDLGRQDPPLAEDIDNMKNNKLATAESAGPHDSLGHAGLPQSPAKMGN
STDPGPTPAIPAMATNPQNAASRRMPNNPGNPSNPGPPKTPENSLIVTNPSGTQTNSAKT
ARKPDHTTVDIPPACPPPLNHTVVQVNKNANPDPLPKKEDEKKEEEEDDRGEDGPKPMPP
YSSMFILSTTNPLRRLCHYILNLRYFEMCILMVIAMSSIALAAEDPVQPNAPRNNVLRYF
DYVFTGVFTFEMVIKMIDLGLVLHQGAYFRDLWNILDFIVVSGALVAFAFTGNSKGKDIN
TIKSLRVLRVLRPLKTIKRLPKLKAVFDCVVNSLKNVFNILIVYMLFMFIFAVVAVQLFK
GKFFHCTDESKEFEKDCRGKYLLYEKNEVKARDREWKKYEFHYDNVLWALLTLFTVSTGE
GWPQVLKHSVDATFENQGPSPGYRMEMSIFYVVYFVVFPFFFVNIFVALIIITFQEQGDK
MMEEYSLEKNERACIDFAISAKPLTRHMPQNKQSFQYRMWQFVVSPPFEYTIMAMIALNT
IVLMMKFYGASVAYENALRVFNIVFTSLFSLECVLKVMAFGILNYFRDAWNIFDFVTVLG
SITDILVTEFGNNFINLSFLRLFRAARLIKLLRQGYTIRILLWTFVQSFKALPYVCLLIA
MLFFIYAIIGMQVFGNIGIDVEDEDSDEDEFQITEHNNFRTFFQALMLLFRSATGEAWHN
IMLSCLSGKPCDKNSGILTRECGNEFAYFYFVSFIFLCSFLMLNLFVAVIMDNFEYLTRD
SSILGPHHLDEYVRVWAEYDPAAWGRMPYLDMYQMLRHMSPPLGLGKKCPARVAYKRLLR
MDLPVADDNTVHFNSTLMALIRTALDIKIAKGGADKQQMDAELRKEMMAIWPNLSQKTLD
LLVTPHKSTDLTVGKIYAAMMIMEYYRQSKAKKLQAMREEQDRTPLMFQRMEPPSPTQEG
GPGQNALPSAQLDPGGALMAHESGLKESPSWVTQRAQEMFQKTGTWSPERGPPTDMPNSQ
PNSQSVEMREMGRDGYSDSEHYLPMEGQGRAASMPRLPAENQRRRGRPRGNNLSTISDTS
PMKRSASVLGPKARRLDDYSLERVPPEENQRHHQRRRDRSHRTSERSLGRYTDVDTGLGT
DLSMTTQSGDLPSKERDQERGRPKDRKHRQHHHHHHHHHPPPPDKDRYAQERPDHGRARA
RDQRWSRSPSEGREHMVHRQGSSSVSGSPAPSTSGTSTPRRGRRQLPQTPSTPRPHVSYS
PVIRKAGGSGPPQQQQQAVARPGRAATSGPRRYPGPTAEPLAGDRPPTGGHSSGRSPRME
RRVPGPARSESPRACRHGGARWPASGPHVSEGPPGPRHHGYYRGSDYDEADGPGSGGGGE
AMAGAYDPPPPARHASSGATGRSPRTPRASGPACASPSRHGRRLPNGYYPAHGLARPRGP
GSRKGLHEPYSESDDDWC

BLAST