GenomeNet

>tr:F7FW49_ORNAN [F7FW49] RecName: Full=Voltage-dependent L-type calcium channel subunit alpha {ECO:0000256|RuleBase:RU003808};
MSGSQNGKALQPHPHPSRPKLSPGPEWGLSLEPRAGGPDHPGSDTPRRRLQHGKHKSQGA
GGTQRSPRALFCLSLNNPLRRSCISIVEWKPFDVLILVTIFANCVALGVYIPFPENPNLE
QVEYVFLIIFTAETCLKIVAYGLVLHPSAYIRNGWNLLDFVIVVVGLFSVLLEQAPNRSR
DAHHPSGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKAMVPLLHIALLVLFVI
IIYAIIGLELFIGRMHKTCFYVGSELEAEEDPSPCAFSGHGRQCTTNNTECRGRWAGPNG
GITNFDNFFFAMLTVFQCITMEGWTDVLYWMQDAMGHELPWLYFVSLVIFGSFFVLNLVL
GVLSGEFSKEREKAKARGDFQKLREKQQMEEDLRGYLDWITQAEDLEPDDGQGEEEMAKE
RRHHRVTLADLTDKKRSRLHWFSHSTRSASSHASLPASETASVTTENTGEEEATGCCATC
IVKIAKTKVCRWLRRSNRLLRRKCRLAVKSASFYWMVLLLVFLNTLTIASEHHNQPPWLT
QIQAYANKVLLSLFTLEMLLKLYSLGPQAYGVSFFNRFDCFVVCGGILETALVELDIMQP
LGISVLRCVRLLRIFKVTRSEPGGGEGLGCCGGLWGQGAGRPESWEVEGLGDCPIPIERK
GGAVNRWAKRKRMSSLSPFPSFFLPASHILTGEDWNSVMYDGIMAYGGPFFPGMLVCVYF
IILFICGNYILLNVFLAIAVDNLAGGDNINTSKGQDNPDYLGPPTPPLPHHPQGQEENGG
EERGRGADAGSWRFGDEGGEEEDSEAESLAESQLEKLQEVVPKEKVVPIPEGSSFFCLSQ
TNPWKPLCHVTRHPTHHFFVGLSQAFRTVHCIRWEYCLHSPWLRPLLSLPCLAFPTPLYS
SQFLRVELQQMTAFGAFLHKGSFCRNWFNLLDLLVVSVSLISFGIHSSAISVVKILRVLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQLFKGKFYSCTDE
AKHNPGECKGTFIVYQDGDVNHPMVRERVWHNSDFNFDNVLAGMMALFTVSTFEGWPELT
ERGTEGKKGPGGVLSRADEGSRRGPPRPHLRIHHRAQGEQEYKNCELDKNQRQCVEYALK
AQPLRRYIPKNPTQHRVWAAVNSTAFEYIMFVLILLNTIALAMQHYEQTAPFNYAMDILN
MVFTGLFTAEMLLKIIAFKPKHYFCDAWNTFDALIVVGSLVDIAVTEVNNGGHLGESSED
SSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTFIKSFQALPYVALLIAMIFFIYAVIGM
QTFGKVAMQDGTQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLASLPGKRCDPESDYGP
GEEFTCGSNFAIVYFISFFMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIW
SEYDPAAKGRIKHLDVVALLRRIQPPLGFGKLCPHRVACKRLVAMNMPLDADGTVTFNAT
LFALVRTSLRIKTEGNLDLANQELRIVIKKIWKRTKPRLLDEVIPTPEEEEVTVGKFYAT
FLIQDYFRKFRRRKERGLLGSEASPSRSSALQAGLKSLQDLAPEMRQALSCDLKGGETEG
QKAESRLAPDNPRPPSRWTSATSLPLNTGDSEPSTGGPPGSLSSPAASQPRGPRGPGEEE
EEEEGSPSPGQPMESRLGPHSLRGQEGREEEWSGGGFTRAQTGAETRPGGPCFLPRPFRH
FSQSRAAGRLDGHRAQRRRLLPPTPAGRKPSFTIQCLRRQGSCEDMPIPGTYHQNPPPGR
RRPQNSWANPVPRGRLLYAPLILVEEARGNGWYQEEPEGPYRAYTQLRVPTQRPSGSRGK
RGSADSLVEAVSLGRPRWKQGPEGVALPKGKIANPVQLENEEMENAANDLL

BLAST