GenomeNet

>tr:F8B690_FRADG [F8B690] SubName: Full=Ryanodine receptor Ryr {ECO:0000313|EMBL:AEH08060.1};
MTGIPDERAGGGRALWLMFAVLFLVAAFLGAWGLTQLDQPDSRCPPPDTRACRYPAADIA
YFDAQLFLLASEPLQDGGPFPLPLEVARFLAPFATAYGVTASVWNILVDRRHRRAARRAQ
EHAVVVGDDPFALTITTALRAAGTTVIRVTGDADQHAQGLVVVGDAWKPATLRAAGVPRA
TTVYACLADNAANAAVVAAVAALTGEEGDHPEPLACYARISDGELALALKARRLGLSAGS
GFRLDFFTPEEIAARKLATHILEPHLGTGDPLPSVAVVGLGPFGRALIVALARLWRVRSG
APPLPLVLVDTHASAQLAELRTRYPPVAAHCAPRVRDEPATTVDLGTVLPEPPSAGASGD
AGTLGIRHLVLCDQNEDTVLPRALNTTRNTVDVGQIVTVCTGQRTALGDLLNPRLLDSAP
GEVRIFAITDEAAEPDELRNDTLTVLARAIHEQYLIDEQAKGRTIGSAEPMDLWDDLRDD
LRAANYRQAEDIGVKLGKISAVVVPMTDPPTDFSFTPAEIDLLARHEHERWCAERRGQGW
TFAPVRDDSRRRHNLLVDWLDLPDDQRAKAIATVRHLPALLADHGLQILRLG

BLAST