GenomeNet

>tr:F8FA29_PAEMK [F8FA29] RecName: Full=30S ribosomal protein S5 {ECO:0000256|HAMAP-Rule:MF_01307, ECO:0000256|SAAS:SAAS00382345};
MRIDPNTLELSEKVVQINRVAKVVKGGRRFSFSALVVVGDGNGWVGAGIGKASEVPDAIR
KGIEDAKKNLIHVPIVGTTIPHLVTGKFGAGQVLLKPASKGTGVIAGGPVRAVLELAGVG
DILTKSLGSSNSMNMVNATLEGLQRLKRAEDVAKLRGKTVEELLG

BLAST