GenomeNet

>tr:G0R8K5_HYPJQ [G0R8K5] SubName: Full=Predicted protein {ECO:0000313|EMBL:EGR52897.1};
MGSVDTSIHSAASGAAAQLVARHADEQPLKLYAGWFCPFVQRAWMTLEEKKIPYQYIEIN
PYKKEPDFLKLNPRGLVPTLGVPVDAAGTQQKPLFESSIIMEYLDEAYADEAQHGPRLLP
GDPYQRARARLWIDHVNSRIIPAFYKFLQHTPEKDYSIDEAREELHKHIKTLVAEMDPEG
PWFLGRDISLVDISLAPWAKRLFLINHYKPGGLQIPGEGGEGNVWTRWSSWMKAIEDRPS
VKNTWSEEDKYIEVYKRYAEDTTNSQVGQATRKGTKLP

BLAST