GenomeNet

>tr:G1LH77_AILME [G1LH77] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSAMEP00000006271};
YGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRADKRRAQKKARLAR
IRAAKTGSANAYMQSKRNGLLSNQLQCSQSSEDEQAFVSKSGSSFETQHHHLLHCLEKTT
VRKRHDCPPSLSCSHRCRQNHEFVDEQVFEESCMEVATGNRPSSHSPSLSSQQGVTSTCC
SRRHKKTFRIPNANVSGSHRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQ
PYVTTAIISIPTPPVTTPEGDDRPESPEYSGGNIVRVSAL

BLAST