GenomeNet

>tr:G3HQV8_CRIGR [G3HQV8] RecName: Full=Sodium channel protein {ECO:0000256|RuleBase:RU361132};
MLVSGGGGTMTVMWTVFSMWVLGTTEVPSLPPRQPEEILCPQKQDEKMANFLLPRGTSSF
RRFTRESLAAIEKRMAEKQARGSATSQESREGLPEEEAPQPQLDLQASKKLPDLYGNPPR
ELIGEPLEDLDPFYSTQKTFIVLNKGKTIFRFSATNAFMFIMCTILTNCVFMAQHDPPPW
TKYVEYTFTAIYTFESLVKILARGFCLHAFTFLRDPWNWLDFSVIVMAYTTEFVDLGNVS
ALRTFRVLRALKTISVISGLKTIVGALIQSVKKLADVMVLTVFCLSVFALIGLQLFMGNL
RHKCVRNFTELNGTNGSVESDGLVWDSLDLYLNDPDNYLLKNGTTDVLLCGNSSDAGTCP
EGYRCLKAGENPDHGYTSFDSFAWAFLALFRLMTQDCWERLYQQTLRSAGKIYMVFFMLV
IFLGSFYLVNLILAVVAMAYEEQNQATIAETEEKEKRFQEAMEMLKKEHENRLSLTHGLS
RTSMKPRSSRGSIFTFRRRDQGSEADFADDENSTAGESESHRTSLLVPWPLRHPSAQGQH
SPGTSAPGHVLNGKRNSTVDCNGVVSLLGAGDAEATSPGSHLLRPMVLERPPDTTTPSED
PGGPQMLTPQAPCADGFEEPGARQRALSAVSVLTSALEELEESHRKCPPCWNRFAQRYLI
WECCPLWMSIKQKVKFLVMDPFADLTITMCIVLNTLFMALEHYNMTAEFEEMLQVGNLVF
TGIFTAEMTFKIIALDPYYYFQQGWNIFDSIIVILSLMELGLSRMGNLSVLRSFRLLRVF
KLAKSWPTLNTLIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGRNYSELRHRVSDCG
RLPRWHMMDFFHAFLIIFRILCGEWIETMWDCMEVSGQSLCLLVFLLVMVIGNLVVLNLF
LALLLSSFSADNLTAPDEDGEMNNLQLALARIQRGLRFVKRTTWDFCCGLLRRQPKKPVA
LATHSQLPSCITTPRSPPPPEVEKVPPARKETRFEEDERPGQGTPGDTEPVCVPIAVAES
DTDDQEEEDGEDSLGTEEESSKQAPEDSYSEGSTADVTNTADLLEQIPDLGEDVKDPEDC
FTEGCVRRCPCCTVDTTQAPGKVWWRLRKTCYRIVEHSWFETFIIFMILLSSGALAFEDI
YLEERQTIKVLLEYADKMFTYVFVLEMLLKWVAYGFKKYFTNAWCWLDFLIVDVSLVSLV
ANTLGFAEMGPIKSLRTLRALRPLRALSRFEGMRVVVNALVGAIPSIMNVLLVCLIFWLI
FSIMGVNLFAGKFGRCINQTEGDLPLNYTIVNNKSECESFNVTGELYWTKVKVNFDNVGA
GYLALLQVATFKGWMDIMYAAVDSRGYEEQPQWEHNLYMYIYFVVFIIFGSFFTLNLFIG
VIIDNFNQQKKKIRGQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPLNKYQGFIFDIVTK
QAFDVTIMFLICLNMVTMMVETDDQSPEKVNILAKVNLLFVAIFTGECIVKMAALRHYYF
TNSWNIFDFVVVILSIVGTVLSDIIQKYFFSPTLFRVIRLARIGRILRLIRGAKGIRTLL
FALMMSLPALFNIGLLLFLVMFIYSIFGMANFAYVKWEAGIDDMFNFQTFANSMLCLFQI
TTSAGWDGLLSPILNTGPPYCDPNLPNSNGSRGNCGSPAVGILFFTTYIIISFLIVVNMY
IAIILENFSVATEESTEPLSEDDFDMFYEIWEKFDPEATQFIEYLALSDFADALSEPLRI
AKPNQISLINMDLPMVSGDRIHCMDILFAFTKRVLGESGEMDALKIQMEEKFMAANPSKI
SYEPITTTLRRKHEEVSATVIQRAFRRHLLQRSVKHASFLFRQQAGSGLSDEEAPEREGL
IAYTLNENFSRRSGPPSSSSISSTSFPPSYDSVTRATSDNLPVRASDYSRSEDLADFPPS
PDRDRESIV

BLAST