GenomeNet

>tr:G3VQP1_SARHA [G3VQP1] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSSHAP00000005496};
MGGSSFKMRGTWTHLREILRTWMLREQVWTQSLDEANMLQQKRIWESPLLKAAKENDLCT
LKKLVVDGPCDIHQRGALGETALHIASLYDNLEAAKLLMEVAPELVNEPMTSELYAGQTA
LHMAIVNQNTNLVRALLARGANISARVTGRAFRQNKLFYFGEHPLSFAACVGNEEIVRLL
IEFGANIRAQDHLGNTVLHILVLQPGKNFACQMYNVLLSYDGQGSHLQPLELISNHQGLT
PFKLAGVEGNTVMFNHLMQKRKYIQWTHGPLTSTLYDLTDIDSWGDELSFLELIVSTKNR
QARQILDQTPVKELVNLKWNRFGRPYFYILGAIYVLYMICFTMCCVYRPLKPRNDNQTSS
RDINLFREKCLQESYVTSEDYIRLIGELVSVIGAVAILLSEIPDIFRVGFARYFGRTILG
GPFHVIIIIYAGLVLVTMVMRLTSTSGEVVPMSFALVLGWCNVMYFARGFQMLGPFTIMI
QKMIFGDLLRFCWLMAVVILGFASGGAAFYVIFQTEDPDELGHFFDYPMALFSTFELFLT
IIDGPANYDVDLPFMYSITYAAFAIIATLLMLNLLIAMMGDTHWRVAHERDELWRAQVVA
TTVMLERKLPRCLWPRSGICGREYGLGDRWFLRVEDRQDPNRQRIQRYAHAFNPLGTDDL
DKDSLNKLDLTPPCGHHRLATATPSISRSTTRSSANWERLRRGTLGINLRGEINRGLEEE
EGRVYQV

BLAST