GenomeNet

>tr:G7V9Z4_THELD [G7V9Z4] RecName: Full=V-type ATP synthase subunit I {ECO:0000256|RuleBase:RU361189};
MAVTKFKKASLVVLGEKEEAVVSVLQDLACCEIMPEPTDTRTHDWAKCIKSADEALADIR
SALRFLEPYYSEVSGKLERLLGEKPTVTVEELENLSNSIDLASLSSSVKKIERRMLDIRT
LLSKLDSNEEILIKLRQFPYSLAIISSGTVRISSIVGTLPVAYLERFQGLVAELLASDGE
LFVAPFTPKETDVTVVLMYDKKKADEVAEICEKVPFTKLDFPPELEGTPEEELSKIERNR
TELAKESENLERNAAKLASEWVPTLRNLLDYYSVIRTRYETLVNASRTEKVSVIKFWVPE
PAVGKLKEKLSKFGEELELIIEDPSDDDEPPTLLENPRWALPFEPLTRLYGAPKYGEIDP
TVPMAPFMFLFFGMCLGDGGYGVLIAFAITYLLSKYKIVGDTKNFLHLLLLGALSTIAVG
ALTGSWMGDMIDAFPFLALLKPLKDRLVVLNPMSDPITFLGISLALGVVQILFGLSIAFW
DSLRKKDYMAAFGDNGGWISLLIGLLLLGGVKSGFLGGAAGLLGKILSILGAAVLVATQG
REKTGLFRRLLSGVLSLYNITSYLGDILSYSRLLALGLATSAIAMIVNTLTNLVLSIPFV
GWILSIVIFVGGHLFSVVVNTLGAFIHSLRLQYVEFFSKFYSGGGRIFQPLEYRTRYVKI
VGSKPLGQQSK

BLAST