GenomeNet

>tr:H2J5M1_MARPK [H2J5M1] RecName: Full=V-type ATP synthase subunit I {ECO:0000256|RuleBase:RU361189};
MKKEMIPFTIISNKYELEIISKKILDSNNIEIVPLEKVIDKKILKQLKTEKENPYKQIYD
DFMNIFNSVNRTPKPKVKEIDFPMIIDKDEISNFSEKLNTELENISNKMSELSEKKEILS
KEIELFEKLKNIDIDVSDLKKMKRLKYRIGKLNKLYFERFCDSIKKENIISIILDSDEVN
TWVFIIYDSNLKIEKILSIANFVEYKINEDYAGYPKDILLLLYDEYKSIEYEIEMLNMAK
KKIFFENRRFIYKYFDYIFVLKNIYDLAQNVKFTENFFVISGWTTRETYQELEKHVNTND
YILLLRYAFNDKAPTILNNKGFFKHFEFIVKMFGVPSSDEIDPTPLITLMFLFFYGMMFG
DVGHGFILSALGFWLYKKKGSDLFYVIGASGLSSMLFGVLYGSVFGFEDIIHPLWKRPMD
NINYFLLLSVYFGIAIITVAMILNIANRIRRGEKSFLLFDPNGISGIALYWILLGSVFYM
MKNGVFPKISYIFIITLVVLIYLRSILFEEGKFGEKIVQGFFDLFEVLLGYLSNTLSFIR
LGAFAMNHAGLFLAFYMMAKMTNNPVSSFVILLLGNIIIIVLEGLVVFIQTLRLEYYEFF
TRFFKGDGKEFNPIKYKF

BLAST