GenomeNet

>tr:H2XSF3_CIOIN [H2XSF3] SubName: Full=Uncharacterized protein {ECO:0000313|Ensembl:ENSCINP00000032587};
MAESCDNDEEVHFLRTDDAIYLQCVRQKDQGKVCLAAEGFGNRLCYVEPSQDTDAEPTDA
PRCVFVLSQALSVRALQELLASEEAEGGATHSRTLLYGNAIQLKHELSGMFLTCLTTASS
ANDQLAFDVGLGEEETGETSWWTVHPTSKQRSEGEKVRIGDDLILISISSERYLHLSCGD
GDDSSVQASFQQSMWTVGPVASGGSKAQGYLTGGDAIRLFHGHMDDCLTMHTMDENKSHS
RSIIYESGSAGSHARSLWRLELMQIKWFGSHVSWGCPFRLRHITSGLYLCMLDDRSLMLM
GPENASYRMSAFCWQSSKDKAEPLTEHEIDGMGVPVIKYGDSVCYLQHVETGLWVSYQVV
DTKSVRVGPKQRKAVLHHEGHMDDGLALSRAQSGESRTATIIRRTAQIFLSFISALDSHQ
PKKLGRRPDHPNVAEMEQCVNDLIDYFIEQEDKADDGSTDEHEVRQIRKQELKNRQDLFQ
EEGAISRILQCIDKLGAYGDTGNFAQIVGSEAAASYEFLLNSMYVLLAATVRGNRDNCAK
FARHLDWLISQFDGQQASMGILEVLSAVLSDSQEALNMIKPDHIKSIISLLEKHGRNAKV
LEVLCSLCVCNGVAVRSNQNLICETLLPGRDLLLQTTVLGYITNVQPNIFMGVSASCAQY
KKWYYELLVEKIDPVCSSSGPHLRVGWGNTVGFSPYPVGGDYFGEAGVGDDIYSYGYDGL
NLWTSHRACSVGSNNRHLLAANDIVSCCMDLSIPSISFRINGQPVQGMFEDFNLNGLFFP
VVSFSAGIKVRFLFGGPHGEFKFLPPVGYAPTYEALLPGRRLFLSPCKSYGNLSRGYIMG
PGSSWEHTVFVPNAVNTQNVILSHFLQAVVPKLAESIHELWAMTRIQGGWSYGTVRDEAK
KQNPCLVEFARLPAQERSFNLTMSYETLRTIIALGYHVGIADEEAEYNLRKLKLPQSYIM
ASGYKPSPIDLSHIKLTQQMEDLVEKLANNAHNVWARERVKQGWTYVNLKDVGKKRNPRL
VPFSLLDELAKQSNRNSIRELIRTLIGHGYMIEPPDDRLKDKDTKKKNQVQCNKMRIFRA
ERTHAVQSDKWYFEFTVESKGEIRVGWATPDCLASTDLGADAKAFVFDGHNALKWNNGAE
SFGRRWNAGDVVGCLLDFNEGVISFTLNGELLIDGHGQETAFENLSSDISLVPVVSLAVD
QRGFLNFGRDSGTFKFYSSIGQQEGFQPFAFGMRSPIAMWFTKNLPSFCNIDETDQNIEV
KRLPANNHRPPRLKVIHKQIGGTGSHDFTPDWFYTRLNLPITMATVFTKRLTLCLFLFSP
GHIINLFNESESVMEEDIDNDFEVLRKTARGGLSPPLPAVDLKNERHHHHHHGNSNTLPI
PVYHVKQLCDNELKIYTYKFLKNMFHFSKPKSSMVQGNNGVNNTAKSRLTEEVLPDQYAD
VLYKNDIDQLLQSTQYSFSVRIFPEQDPGSVFVGWVTSDFHWNAEKFQQEFIPTVTITLG
DDKGKVSESVKRSNCFVLWGGDLHQQTSATPPPANQSSPGILVTCIIDISTGLLTFTANG
KNLNTFYQVEPNVRLYPAVFSFPTTHSVFQFELGRSKNCMPLSAAVLECERKNVIPQCPP
RLVVQSLRKVTWTRMPSKLPHPECRRESVRSKGWTSELKPSNTDASILHVPEENRCIDLL
ELTENEELLHFHEQTLKLYRSMCALGNHRVSHALCSYVDQKQLMHVVRNNDLIGSIRATY
HNLLIEMHLAPHANARKNTQHEYMFPLNEMTRSIGLFANPETKDPTLPGVGSTSSLRPSM
HWSQVNFVMHNPSLIHERPLHVPEFPLDELCYNVILQLQDAVVCCYKNCKDIMGKNQQYV
LVPLIRLTTTLLEMGVFVDEDVKKILILLDPNFFGSFMKDMDGVEDKRVIQKYIKNNKLS
NRKQYVDERVYKIIKNAHSGLLCLDLVESVKLVLCDLLEHLMNLVLRHRVEALVSFSCLV
VDHLQQNQRNRYQRVMESVNMSAAMTAKMTREFRSPPMDQMAILLKFKNEELEEECPLPP
SIKDLIWNFHMDMLIHCGETIEDVETNETEIPLRSRLVAFISHILNRKNDKADETGEEQI
EVITSLRDLITSTMVRWAQGSRLNNPQLVRSIFQLLYRQFNGVGEAIQCINKTYCISEIS
EVDTMGLLDSLSRLRSLLSVKLGEEEETLIIKELNTIMNNKVFYQHPNLMRVLCMHETVM
EVMVSVLGGEDDETNSNEVQFPRMVAACCRFLCYFCRISRLNQGALFEHLGFLLEHSAVG
LASPSMRGSTPLDVAAASVMDNNELALALKESDLAKIVEQLGTCGVESCQLLLRKGYPDI
GWNPVEGERYLDFLKNAVFVNGESVEENANLVVRQLIRRTECLGPSLRGEGGHGLLSAIT
SALQICRDRSKDGPDKQVTFKFNTFRNDFDDENDIHMGFSILAFYSTLIDLLGRCAPEQC
LIMQGKSDAIRIRSILRSLVPLEDLIGVISLPFELPRLERDGSTNVREPDLSACFIPDHK
ASMVLFLERVYGVDDPKLMLRLLEVGMLPDMKAAAQLDTPLLHTTDMALSLNRYMCYSLL
PMLVKHVELLEQWQHRVVLIDQLLHTIYRMSQAQALTKAQKEMISNCLVAVAGVLRPSLL
QGLLRKLTFDVPALTEETYVPIRLLTQHYARCWKYYYLHDGCSEFGRATDEEKHITMVLF
WGIFDSLAKKPYQQELFSKVLPCLCSIANALPADYALSPALEQLKEPSITAHGKFVPRPV
DTKCIMLPEKLDTFVNKYSEQWHDTWALERFTAGWTYDSHYNDHFKHHPMLKPYRLLNDR
EKDVYRPTVREGIKTLLAWGWTIRKARDATEQLPAKVRCSSQSNISASEAHGYLPRPYDL
SGVILSREMMRTAEMLAENFHLVWAKKKFNEMEAKMAANSSQPSSPTMTTNPMLVPYDRL
TAKEKEKDRSKSYDLLKFFQFNSYMLTKDEKEELDIKSSVEKRFSSMMLVRLLNYVEKST
VYVNGMIQAAETVKQRRQEHAAFGDHDIKFFAKVGMPFIESYFKTQEIYYVTVSGSLNEG
MSVASNKEKEAVTLLFCKMALLIRQRTAMFGVDASVAINCIKVLAECIDASTITKSCPEH
IKQALITFFNNAAEDLKKMLNHIRSGRMKHLRKMMLGAQTTNYVTHCILPVLTILFRHLG
RHNFGKDLLLDEIQVSCYKILNGLYSLGTGKGAFIDRHRSQVGECLAAFASAFPVPFLEP
RLNKFNSCSIYNILSIKDRKLLGLPPKLEQLTPLLPTLNNLLSDISHLAESGAKYEEAPE
MIDIILPMICRYLPMWWKQGACVAQQTNDKRIPIEESSGCGTAVSGEILNNILRDVLRLI
QNNLGSDEADWMKRIAVYAQPILVQSDPDLLTSHFLPILNKSLKRIQQIRDLEEQVKYEQ
RVNDVSDLELLMLEDYGIIARDLYAFYPLLVRYIDLSKSLWIREKNQNAIALFKLLSEIL
VIWAKSVNFRREEQNFVVQHEIDNMSVLTADKSATPNAASALVSILNFMGKKANRRIVKK
RGDRYSPSTSLIVACVKRMLPVALNMGKVGDCNLLQEAKTRFLKKEMEDDVKEYLISALR
ENFYNTQISICRKVNEDLTNEHGDITTRADWLLEISRVQYHLHLTEHPPKSRRAVWKKLM
SKQRKRAVVSCFRMVPLYNLPIHKVISMFVPSYSQHWVYTDQSNFAGKLINLVHKVFKNQ
PNQEEGKTLHCDPLSQLIQVFSMSAVTSVVNSENDDLYLAYSELMTQSCHTGDDEEEDEG
EESEKSFEEKEKEKQRLLYEQKRLATRGVAEMVLYMISASGGDVSDTIVTTLQLGIALLT
GGNVLVQKIMLDHLKAKKDVRFFTSVAGLMDQCSVLDLNAYERSLKSESLGHVNECTITD
LSLPGEKTMSDAELTCALFRFLQLLCEGHNAGKLDFQNYLRTQVGNNTTVNIIISTVDYL
LRLQEAISDFYWYYSAKETIDAPGQENFSKAIAVAKQVFNTLTEYIQGPCEGNQQALAHS
RLWDAVVGFLHVFANMQMKLSQDSKRQLSLLKELLDLQQDMIVMLLSMLEGNVVDGTIGR
QLVDTLIESSHNVELILRFFNMFLRLKDITSSDKFLEYDAEHTGFVSRKDFQRAMEASKI
YSSEEIDFLLACAVSTDDKLNYDEFTEQFHEPAADIGFNMAVLLTNLAEHMPRDTRLKKF
LEMAEAMLEYFQPNLGRIEIIGSAKRIERVYFNIKPSSLDQWHKPQVQESKRQFFFDVIN
DEGDNGRMEEFVNFCEDTIFEMQLASEISEAGFGASSSSAVNDEEGDDKDEEDAAAKQKT
VYNTEHNIYLHFLSNRSGEILPSFNFKVVKSYVRQFRAMTWIEVITSLVFLFFTFNIKLC
KLSIELLQIFGNFLYVLFFSNFLVVEVKKKSLTEIIDEMPCPTHERIQHSVENLSDSGTD
DTGQDQTKGDKEDFISDVFGMDIKKSKELIKAVVHTKPEAGFGDFTVDEAADTFSLIASD
YESGINTPRTSKIKKRIYGNLSSLENSSTSEQRLSNLKSAMSFDERSGEDNISPWYTCMK
ECGRPARYKHEEKTEDRNAMYLDTWNAFCMGTMGLFARNFYKFKILALGLTFCINFILLF
YKVSTSCDIQSSGVYTMACNQNLIPQQWHSINNDLKVDSESSEDEVEESLILEDTSKYME
PTLRAFSIIHFILSFSMLVSYYGLKVPLVIFKREKEVARKLEFDGLYVNEDPTDDDLSGR
WDKLVISCPSFPSNYWDKFIKKKVLDKFGEQCGQDRIQDLLGMDHSNTSFLDEEEPPKGN
ILTQLFLNVDIKYTVWKTGVIFSDQSFLYLLWYFVMSIFGQYNRFFFSLHLLDIAMCSKG
LRTILTSVTHNGKQLVLTIGLLTVVVYLYTVIAFNFFKKFYNKGEGDDEDWKCNNMFTCF
QFHFYSGVRAGGGIGDELEDPSGDAWEFYRIAFDISFFFFVVVILLAIIQGLIIDAFGEL
RDQQEQVKEDMDTKCFICTIGIDYFDQVPHGFETHTLQEHNLANYMFFLMHLINKDETEH
TGQETYVWQQYQERCWEFFPVGDCFRKQYENELSG

BLAST