GenomeNet

>tr:I1LEE1_SOYBN [I1LEE1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:KRH35663.1, ECO:0000313|EnsemblPlants:GLYMA10G40300.2};
MKVAAEGCNLLLLFITSYLSLISGLGVHSLSYDHSATTKCLAEPRRAQYGGGIIVNPGFD
HNIEGWTVFGKGAIKERISNGGNRFIVAHNRTHPLDSFSQKVQLKKGMLYTFSAWLQVSE
GSDTVSVMFKTKGSKMVRGGQVIAKHGCWTLLKGGIAANFSSPVEILFESKNSNAEIWAD
NISLQPFNKKQWRSLQDASIERVRKRKVRFQISHVNETALIGAKVITRPIKLNFPFGCGM
NHHILTNKDYQSWFVSRFKFTTFTNEMKWYSTEKKQGEENYTIADAMLKFTKENGISVRG
HNIFWDNPKLQPEWVKNLSPEKLGEAAAERMKSVVSRYKGELIAWDVMNENLHFHFYEDK
FGENASAAAYATAYELDQEPKLFLNEFNTIEYSGDEASSPAKYIKKLQEILSFPGVSGMS
AAIGLQGHFASGQPNLAYMRSGLDLLATTGLPIWLTEASVDPQPSQAEYLEEILREAYSH
PAVEGIIMFSGPAQAGFNATTLADETFKNTPAGDVVDKLIQEWGTGPNIATADNRGIVDI
SLHHGDYDVTVTHPLIHSPITLNLCVKKDFSLETIHVKMRA

BLAST