GenomeNet

>tr:I1P1B4_ORYGL [I1P1B4] SubName: Full=Uncharacterized protein {ECO:0000313|EnsemblPlants:ORGLA02G0177000.1};
MFKKHVDVKALQRLSGADKKKLRRTAKERFPQASDADLDAILPPKVEVTVAKYANRVLVY
GIEGEFPMLFDIDGRGHELFPTVYALWKVPDLLPAFTLKGGEVSRFILGGADLMFPGVSI
PPEGLPSFQPGQPWSVKVPGNPAPIAVGATTMSSNEALKAGLRGKALRITHYFKDSLWDS
ADGRYVPNEGFYEDIVVEDPNYASPSQPADSSEDHVEGMHDSTIEGEEAAVDVSESHTTD
HDIHVEAIEDLTAGVSEVKLPEDNATEEPTEEREHQNLSTEEIDSLLDKCLLQALHTSVK
DKDLPIPGSTLWSNHILPCRPTGVTLDIKKSSHKKLSKWLQSKSSAGLISSKEDKHKKEV
MLLRINRGHPDYMAFKPEKRVQEPVVQHDNVVAEGSSTKQLEVAETYKPSSHVNPIFMAV
GADTSKYYSASEASDIVFRYVEKENLVKQTDKAKVVLDVALCDALYKGAIKKGSAYPTEI
HKRDLGSTFLNRMQIHHRVARGNEVVIRKGAIRTIQIMTERRQGNKKMTRLSGLECFLMD
PDSLASELQKKFACSTTTAELPGKKGQHEVLVQGGVIDDLAKHLVDHYGVPKRFIEVLDK
TKR

BLAST