GenomeNet

>tr:J9IT15_9SPIT [J9IT15] SubName: Full=Small-conductance calcium-activated potassium channel protein {ECO:0000313|EMBL:EJY85147.1};
MPQTEGDENMGLNDTKYFNKTNQDFEQTGLQVDNYDKIQQFEENLNEQINRTLQKASRAF
EVKLKAKRRRQKTQSFEDQERAINKHLKIIDTVVALVAIIIGVVTYNEGEVAISVNTFMT
EVEVSSLNGNNEIVTSTETVDRYNVTYISNAQTDQYRMAMVFFTFILNFLILIRYQRLLK
RMKVQRLIPPKAGCWRAGLVPKLFLELIICSTISPPGVNFTFSGKLDGGSYQYSFDAVMN
IIALCKSYLIVRIYWHYCSWNTNAAIRVGKRHDQKIDLIFAIKSELKYRPFVMVGFIMVV
SIFYLGFIIRTCELSFVNKDGIDNVDKFKPILNSAWLTIITMTTVGYGDLYPQTFFGRFF
GVLSFIVGNVLISLIVVVLSNETNFEPAEAKAYNTLKKEMAQDKALGRAADVIRTSMRLY
KSKIRRDGRSFSLRFIFYSQLKSQIKLFKNVNKQAESHSLPAATLIQNMIDKHKEDMDTI
KEAYDESPSIAMRLEQLQDRVDRMDRAMSRISNIERRMALFFIDLNNKVYEQEAKLKEIE
RLKKDGGAKKQLSGNLSKANTGNISPIIKL

BLAST