GenomeNet

>tr:K1P2H6_CRAGI [K1P2H6] SubName: Full=Potassium voltage-gated channel protein Shaw {ECO:0000313|EMBL:EKC18012.1};
MSTLKKIPDSRLGSLSPASPEYNAETDEYFFDHSPVLFNEILDLYRTGELHVPSNCCGAV
LQRELEYWKIPKCLISECCIHSYHSYVQAQNTIQSIRESFEDNILDYSPTEYRNSKMKKM
FRTIWITLDQPKSSTCAKVINALYLALVLLSVLVFLLSYQPYCRNETMTHEKLVYMKNYS
TISLFQSVNLNNAKQVMFLTTEIHPLLDNIDLFCIVFFTLELFAHFFTCPRKIKFFTYVL
NVLDLYLVVAMWTTFAIETQIEKYLNDSGMINFYTVLKASLVLRLLRFFRLMKQFSALKI
LFMSLKASIKELLLLFITFLLASVFFASFVYFAEFNEQDVFPTIIESVWWAIITMTTVGY
GDMYPTSFGGKLVGIACAASGILIIAMPIAVVAANFSEYYLKNSERRLRGRLMKSKKKKR
SCCSWGESPQVNHYSSSPPSPRNLLKRQNSKLTGIIASNSKSNGTSKKQKGKKTKNLPNG
VQKRDAPSSAISRKSVTNENHGIWYDVPDLRVH

BLAST