GenomeNet

>tr:L0P9W3_PNEJ8 [L0P9W3] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:CCJ29173.1};
MKIAFVHPDLGIGGAERFTVDAAVGLQTLGHDIVIYTSHCSQDHCFDEVKKGIVQVKVRG
SGIPTKIFGKFSILCAIFRQLYLSVCMLLEKDIYDVIIMDLLPFSVPLLQKKCLKLLFYC
HFPDKLLARRDSFLRKVYRLPFDWIEEWTLLMADRVLVNSCFTASIVRKVFPNIKDLTVL
YPSINIYQEIVLDEPLLIRRSYIHLILSINRFERKKDIALAIRSYSRFKGISCSSKCCLI
IAGGYESRIEENVQYHNELVDLCNCFSLKSKTFRHPYVFPLDFSGYDVVFLLSISTTLKN
CLLREASILLYTPPYEHFGIVPLEAMLHRTIVLAQNNGGPLETIDDSVTGWLRKPDDDEW
AYTLENVLFKLTDDERAAMGERGRQKVINLFSRENMAQTLEGYILETNRKKLLQTSMLLK
IQNMSLYSFESK

BLAST