GenomeNet

>tr:L1QMV8_9CLOT [L1QMV8] SubName: Full=Carbohydrate binding domain protein {ECO:0000313|EMBL:EKY28897.1};
MTLNNSAGRSAILFRYESPSSFAGIAYDTNGAWVWLSEGSYGTLPFTKVLEPGTEYKINI
KYVGTHITIVIDDEVMYQGEISGIKTTAGRIGTRNWGWTGNYGSSTFDYFKNGKFSSVTL
DSDYKYVLYNEAGTYDIPITLTGDNTLSKLTVGGNTLVEGEDYILTDNILVIKKEYIEKV
KEGGTTNINIIFEDGYLTTFKLQVQLPPDEAASYIRDFSTDGIGGLSVIKGSGSAELQED
KLLFKSDGNSILIDENSPELFNSSVEFVVDPLTDAANIGAIVRYSEDDNSWTYIGQDGSG
NQYGSYWYVENSNGQRRALVQDTARIYANRVKPYKIKVKVVENAVSIYLDGAEIYNGVVP
ELTSKKGKAGIRLGGNNSGKYQYLSVESEEVLSTNVNEVTEKEISSNDLTVKMDASFPRV
IDYTLNDKKLYGQEKPIYYISINNKNYVPKVTSEFNGNEAVYHLYVEELGVTLDTRFTVE
NNVLTMNIENVDESITRVDTINFPNHSLVSVRSNQTNAEFNGADYENDDVKINLTSKRED
TTYSNTNIAILSCDDLAASITSNSIKLRDQINYQTVSVDDYYSTGLWPNEYLYRGIDGEL
INEPYAKVTITDDRNKDNSVDYQDGAIALRDDIQENRLGSELVNQTYSSVAMNVGSTAHY
PFLRILDNIKKFNLATDGFGQTIIIKGYQSEGHDSSHPDFANISNRLGGEEAFRILLEES
DKYNANIGVHINHTEAYPEAPQYGSNIVSTVGGWSWYDDSKQIIRENDIMNEESGMGARL
EELIEKAPGLDMIYVDVYMDTRWPAYKLTSKLNDLGIAVASEYAKQLGTTSVWAHHAYNG
GYGTSSELARFVNHQEQDVFGGTNLFRGNSRQGINGWQGESNLNTTVSNFFTSQLPFKYL
MNFPISIWEDNQITFGENNEVVSKMDNGVNVITQDGKEVARGNKIFIPWTIDNEEKIYHW
NDSNSSTTWDLPNSWAGLETVYLYELSDEGKINETVVNVVNNKVTLEVKKNAGYVVYKGE
KAQEKMEWSTGSLVKDMGFDSHSFEYWNKSSNGKSTDHIEVVNNSKGNTHIKVSGTDDAL
ISQTITGLEPGQTYSASAWFEVSDGRRGTLSILTSDGKEVSEYIDRCNVKYGHTHSDKTN
SYYQRVRVNFTVPEDSTTATIQLKAAEGAAGSFVNMDDVLVMKIGVSDKQGHDFFEDYEN
VDFGYGPFISTSSDHSHLSETNAPYTNDTIEGRYSLKIRNGNYMRTIPSTMRLKPNTTYR
VGFDYISYAEQGFIAAIKSDKASEAGDTANAVLKTADLNTGTNQAVLEFTTGNYDDYYLD
LTKQNNNNLIVDNVFVDEIVNISIDTLVELVNELKALDESAYTTESLNSLKDKIKDAETV
INKANATEDEVKNAYNELTKAKEALVRYATVAEVNDLKATIEEMKAINSNDYKQNDKWTV
FQEKIVEAEKLVKENKITVIQITSIKSELYKAKSELTKVDSADKANIEALLLEAQSAKEE
DYAQNTAWQDFKQDITEAVAIIANESATQEEVDYRYNKLKESYDSIVPTNKTFIKHFSRT
SRWI

BLAST