GenomeNet

>tr:Q23DY9_TETTS [Q23DY9] SubName: Full=Cation channel family protein {ECO:0000313|EMBL:EAR94798.2};
MKQSTENNQNDEHGQQKSSKWIQKLKTIFENELPSSSKKKQKIKDKKVILQTQDSQTDDY
EENSDDVNSQDMSFLQNKKDKKKEQLKFLYEQIAAEMNQKDDGNNHDEEDLWDWMRNQNK
YEEKDSDEQLIHSFQEQEAEFLALKEKEEQNKFLDIVEMNEYQKIQKFNADTLPRKIFKQ
IWSIKNAISQICNIIINSKPFEYATLCVILFNCVILAMDDPTTNADDQQRLQIDLILLIL
YTVEMGFKILALGFIFNKGSYMRDMWNILDITIIITGYLPYVVNTSQVNLSAVRSLRVLR
PLRTISRIKALKQILNTLFSSFSLLKDAIIIIIFFYLVFAIAGQQLFTGCLKKRCFDSSN
GIQFGDNDQNVFLCIEDIDCYQYAESNSKIHYICGKGMVSPFWDTENFDTFGWALLNVYV
VVSQEGWSTIQAQVQQTFGYPSFIYFMICVLVGNMFLENLLMAIIQIKYEESERLLKKRQ
KAIEDVQSFNLADFIRWGIYKSNKQVYKELEEKKIKKVSTLSEIISFFKQGAQIKKLFTI
TKSKSNSGSPNNKDKQIEENIHNFKSIEELENQSADKNQAEKLGKEQKVQQQPANLGTQF
EQSKPLIEQELQEIHDQNLNTFKSQETNLNLLLKIPMIGLKESQLSVFNNYNSNFSPTYS
VAHFSHNIKQNQELANFTYEDQNLNLNKLQKSIHIKDLDQMANNQQSQFPKFNPIMKRQP
QYLKKSSIREKSPKRGYQRKNSRKMTTKKTMIIKPLEGTQTQIRNSVSNNNNTQIRLTVA
KNMNSSHQSRNPSEIHQNSQLNQTNFQRDKSVNQNTYISNNTYHQGSNQQTIMLQPSVIL
KSKQNRNSNVLNILNSQIIPARKVESDEGSSIDSHQNKDFDEEEQFFKEIEKTYEINQKL
NRQLELKETEDNQYIENIIKDRQIERNYRQKTVTLDNLINNQINKQPLHHDQLSLSSIQE
SYQKDTPEEQNLMFQSIQKRSFKKKREVSIQGQLQSSEISRPYDPESPKKAMSSKRIKQL
PNIPSASLNTSSKIQKSSHVSIILENSLNNSKQKQIRSASQTDFKVDSKQSILEQRKNSY
FYDGLFSDEDFDNVKQFRKQISKKTSIASKTGNNKNKKELQKKKSVKDKNVVDENPKVSI
INQVLSKDEGQLYRKLFLKKDVIARVLYKEPTNYDDDILPKEKLIKKEKKKQDRLDKLKK
MKFSISYQAEKRVKLRSQVVEEKKKKMEKMKFLPIKANRTALALIHQQPQVYPGGVNPLD
LAAAQNKIKSQTLIGQQNTQKNNHENMSQGTYNRAPSIVQQLLKQQTLILQKGKIDDEKV
RLQGDASQKNNLIPQSALSLEYFENQEKIKKGLNLIIPDSDKNSQSNTGSQQVIEANLIQ
KKGTLGNNDQSDQLLKANLTPKTAKGILKIKSITGNENSNLNTELNRSQTNKQLDESLLN
KKKTSGYTGNTGRHQGDNPAFEWDLIKAREMLFPTDHEEEEKSQRESEFSQVFGDNASIF
NSILDESKSKNSFNSSSFHQSYGTSSKFESSSMNSYSMKSQSKEGKSAFDETNADTASKR
SKYSKNKDDTNSKAQDSNKSKDGKEDKGNGENQDYFQKPQTLEQFLKEPLEKEYVQVVKQ
QVNNLIQKGQNKIKSYWSGDDVLVATKVYKQQQAIKTLMKCLNYPNTITEQNEGGFMGIV
NAFRRRVRMLVQTPLYENLIMIAVVMNTVILSLDGSVDNQSILDQFNQAFTYIFAIDMGL
KLIGLGFALYCADRMNIFDGLIVILSIFDIIFLSGSSGGSSFSAFRSLRILRVFRVLRVT
RLLRSLKFMKILIKVISSILDKLFYIILLLILYIFIYTLIGMQLYGGSFLSVSRSNRMVF
DSFLQASFSVYDLLTIENWNNILYVALRTQVNVGITCIYLISCIFIGNFIIMNLVLATMI
GAFNSSQFDKEKEEIANTVEIVEDLDLGHTTTLNSTTFMNMSNSQSRLGSSTHSFSVKNR
QRMLSSGGSSQGYSDEHSQNNHSQHSFSKKSQQIQKESFSREYKEKASSISDSHNQSLDN
KSSHNLELQIVSEQEQNNDKNNQKNMFKQQAVVKKDEDDEKEEIFLFFDNIKCQKSLYIF
SMQNKIRRAFYFIVKNPLFDNIILAGIILNSVKLVSDTYDTGSDSQKQASQILDIMFTVF
FSIESCLKIVSYGFFFDENSYLRDNWSKLDFFVVVTSIIDVSLQNGNFASLKILRLLRTL
RPLRVLHHNKSMKLIVTTLLESIVGILNMLLVIFLVWLMFAILGVSLMGGKLQYCNFPNN
GISYNIYKYNQSQCSRVGGSWQTYDLNFDNVPAALLNLFVISTFEGWPAYVFNYLDGSSD
GPVYFGSAYFSIYIVFFILVGSFFSIDLFGAVLSFHYDIALQKSKNKYLSSEQTQWIELQ
RLILQSKPDYNSISLPTNKFRKFIWNICESQKLEIFIMICIIGNIVSMALSYDTSPSSYD
TILQDINLGFSIVFITECLLKLIAYGFNGYFYKSSNQFDFFVVSVSVIDIIFTYSGNQFI
KFLSAGPQIARIFRVFRVTRLLRLIKQFEGLQKLMSTLIYALPSLTNATALLFLIYFIFA
ILACYLYSPYQTGNSLNSFQNFSTFHRSYLLLFRMSTGEDWYLIMFDIIHHTNMWSAFFF
VVFIIIQQYIMMSLFILIIIEQFENNYINPDNPINDFQYSEEDFKKQWVQFTRNSYGIKI
HERFITDFYFSILRPLGFDYKSKLKEFVEQVKTINQQVSEQDLELITGKFRIKQKQLAEK
EIMKMNIRCDYDGYIFYNELLYYFFKHSLYDSVFGRIDNASTKSEYEKCIKAEEILYKEE
HITRRKLRILKKKQAALTKQKFISSRQKEVNPMVRRLFVGMCFKSWLKYSQKIQNNIMQD
YDDISSQTDSDEEYDQLQVDPEDLQNALAIDKFYTSQDKEENIIEVLKNRRFIIPRLHTI
KLRKQDQKEQIADGFFNGKYFEFPNPDEIYKAELENEQNINEFEERINEQQKQLQIIKNN
EQNNKQMLSSVNSNYQERTKSIQRSQLNNQRNNTLKLSHAFNIPSKRTSIDVNNLNLIHS
NNLLSIQNVQSNNQLVPKDQTKLKLSLVESSNSLGMSVRKESIVKKDSHNVSTPKSQLNL
SQVKKLTLQKNNSNSPRLQVPLENNRQRKDSKSIFSMTPQNRANENENIEDKLNSQHLMH
LQATPITFTQFVNSKNFMSSPENESDDEHKQQIRLDLTKQQSSQIKSPKKEISRFGESSS
IINQLKQDFNINGHEKNNESNDKHSSIMNMPNLQQKSYSQQSDKHQAKIPIDNQEHKKPN
LNKNIPQIRINFEED

BLAST