GenomeNet

>tr:Q83KA6_SHIFL [Q83KA6] SubName: Full=Glutathione S-transferase,GST-like protein yfcG,GSH-dependent disulfide bond oxidoreductase,maleylacetoacetate isomerase,Glutathione S-transferase, C-terminal domain {ECO:0000313|EMBL:CDX07781.1}; SubName: Full=Putative S-transferase {ECO:0000313|EMBL:AAN43891.1};
MIDLYFAPTPNGHKITLFLEEAELDYRLIKVDLGKGGQFRPEFLRISPNNKIPAIVDHSP
ADGGEPLSLFESAAILLYLAEKTGLFLSHETRERAATLQWLFWQVGGLGPMLGQNHHFNH
AAPQTIPYAIERYQVETQRLYHVLNKRLENSPWLGGENYSIADIACWPWVNAWTRLRIDL
AMYPAVKNWHERIRSRPATGQALLKAQLGDERSDS

BLAST