GenomeNet

>tr:Q99XM1_STRP1 [Q99XM1] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:AAK34782.1};
MSAKEQLKELKPLFALITLFEEQRDKDIKLINAFHNPEAIRHIEKGTAKQLLYLAKERDK
RLAMIATLQDERQIAVIKARYVDDLSWDEILDKLGYSINTVFKLHRKALEVLDEQEERYS

BLAST