GenomeNet

>tr:Q99XM1_STRP1 [Q99XM1] SubName: Full=Putative uncharacterized protein;
MSAKEQLKELKPLFALITLFEEQRDKDIKLINAFHNPEAIRHIEKGTAKQLLYLAKERDK
RLAMIATLQDERQIAVIKARYVDDLSWDEILDKLGYSINTVFKLHRKALEVLDEQEERYS

BLAST