GenomeNet

>sp:LIGD_PSEAE [Q9I1X7] RecName: Full=Multifunctional non-homologous end joining protein LigD; AltName: Full=NHEJ DNA polymerase; Includes: RecName: Full=3'-phosphoesterase; Short=3'-ribonuclease/3'-phosphatase; Includes: RecName: Full=DNA ligase D; Short=LigD; EC=6.5.1.1; AltName: Full=Polydeoxyribonucleotide synthase [ATP]; Includes: RecName: Full=DNA repair polymerase; Short=Pol; AltName: Full=Polymerase/primase;
MPSSKPLAEYARKRDFRQTPEPSGRKPRKDSTGLLRYCVQKHDASRLHYDFRLELDGTLK
SWAVPKGPCLDPAVKRLAVQVEDHPLDYADFEGSIPQGHYGAGDVIVWDRGAWTPLDDPR
EGLEKGHLSFALDGEKLSGRWHLIRTNLRGKQSQWFLVKAKDGEARSLDRFDVLKERPDS
VLSERTLLPRHGEAATPAARPARRGKSGGKTPMPEWIAPELASLVEQPPRGEWAYELKLD
GYRLMSRIEDGHVRLLTRNGHDWTERLPHLEKALAGLGLQRSWLDGELVVLDEEGRPDFQ
ALQNAFEEGRGENILYVLFDLPYHEGEDLRDVALEERRARLEALLEGRDEDPLRFSATLA
EDPRDLLASACKLGLEGVIGKRLGSAYRSRRSNDWIKLKCQLRQEFVIVGYTEPKGSRRH
IGALLLGLYSPDEERRLRYAGKVGSGFTAASLKKVRERLEPLAVRSSPLAKVPPARETGS
VQWVRPQQLCEVSYAQMTRGGIIRQAVFHGLREDKPAREVTGERPAGPPPLRGARKASAG
ASRAATAGVRISHPQRLIDPSIQASKLELAEFHARYADLLLRDLRERPVSLVRGPDGIGG
ELFFQKHAARLKIPGIVQLDPALDPGHPPLLQIRSAEALVGAVQMGSIEFHTWNASLANL
ERPDRFVLDLDPDPALPWKRMLEATQLSLTLLDELGLRAFLKTSGGKGMHLLVPLERRHG
WDEVKDFAQAISQHLARLMPERFSAVSGPRNRVGKIFVDYLRNSRGASTVAAYSVRAREG
LPVSVPVFREELDSLQGANQWNLRSLPQRLDELAGDDPWADYAGTRQRISAAMRRQLGRG

BLAST