GenomeNet

>tr:T1INA8_STRMM [T1INA8] SubName: Full=Uncharacterized protein {ECO:0000313|EnsemblMetazoa:SMAR002485-PA};
MLGRKQSLRGGETILADYGPDETLNENADIEWVNKIWVRRLLRVCALLSLVSVSLNTPST
FMKYPYLQYMLFCCDLFVSFLFTAEMIAKMHIRGLLKIYHQGEVPYLRDRWCQFDSTMVI
FLWGSVILQVFEMTKPAEFVPSYLTILRAPRPLIMIRFIRVFLKFSMPKSRINQIFKRSS
QQIYNVTLFYLFFMSLYGLLGVQFFGELKSHCVSNDSTDSISITLNNLAIPDTYCSMDPT
AGYQCPQGMKCMELRLSKYILGFNGFDEFATSFFTVYQAASQEGWVFIMYRAIDSLPGWR
ASFYFTTMIFFLAWLVKNVFIAVITETFNEIRVQFQQMWGVRGQITCESTSQLLTTSDVG
WKLITVDETKPRGKAPRVFQKILQSAVFHVIIMSVLLTNAITAASIHHKHDGKIRQEDFP
DKFYIAEIGFTLFFILEVVFKIWCLGFQNYFKRSLHKMELFLAVGTTAHLIPPLYLSAFT
YFQVLRVVRLIKASPMLEDFVYKIFGPGKKLGSLIIFTMCLLIITSSISMQLFCFMQKFE
TFPEAFMAMFQILTQEGWIEIMDETMHRTSETIAPLVAIYFIMYHLFVTLIVLSLFVAVI
LDNLELDENIKKIKQLKAREQSAGIKETLPLRLCIFEKFPDQPQMIKLHRIPSDFGLPKV
RESFMRQFVEEDEDEPVLVVAKPGVVDAIIAYKKLKPLKLLQSPTRTRVSSSEQKKAGVV
SVLSDSNNQRLLLGDSGNIPVPKTQIGNQKHVRLDQKSTRRSVRAGSMKIKQTYDHLKEN
GDIQAMNSTSASRRPQDLDIKMLQQKRQQAEMRRTQREEDLRENHPLFDTPLFAVGREST
FRKYCQIIVYARYDPHQRDPITGKERKIKYKRLHNLLGLVTYLDLVMIVVTTLSCISMMF
ETPERRVMNTPELQVAEYGFVVFMSIELSLKILADGLFFTPKALIRDVSGIQDIFIYIVN
LVFTCWMPANVPPQSGTQVLMILRCVRPLRIFNLVPHMRKVVYELCRGFKEILLVSILLI
ILMFVFASYGVQMYGGRLARCNDPEILSREKCVGVFMRKIFVTKMKLKPGENETHPAMLV
PRVANPRNFNFDTLGRSLLTLFEVLSLEGWLDIRDIIIDRMGYLHAIYIHIFVFLGCMIG
LTLFVGVVIANYSENKGTALLTVDQRRWCDLKKRLKIAQPLHLPPRPDGHKFRAFIYDIT
QNIFFKRFIAILVLANSSLLCVTWESDEPHTIPLATVSSAFTWLFVIEVIMKIVAFTAHG
YWQSRRNRYDLFVTFLGVIWVMMHYLMMNDFSNSFGFVVIILRFFTITGKHATLKMLMLT
VVVSVYKSFFIIMGMFLLILFYALAGVILFGTVKYGEGINRVANFQTAANGVGMLFRIVT
GEDWNKIMHDCMISAPYCTQGKDYWDTDCGNFTGSIIYFCSFYVIITYIVLNLLVAIIME
NFSLFYSNEEDALLSYADIRNFQNTWNIVDVNQRGVIPVRKVKFVLRLLKGRLEVDPEKD
RLLFKHMCYELERLHNGDDVTFHDVLNMLSYRSVDIRKSLQLEELLAREELEYIIEEEVA
KQTIRQWLDKCLKRIRTKEQSSLINSLRATNEAILAGIEQEKVKAAASEAVKEEAKEDTA
SAMRLRKKGMLTGRSDSISSQGVMTKSVGIKSERKFLAPMLSEGGPRIDKERLNAKKRTT
RPPGTKNLPDVSERNELPSPIRDVPAGKLVQPRYSKSVTEVKEWWKWQVGSNSGSDTDED
VL

BLAST