GenomeNet

>tr:V5GVN3_KALBG [V5GVN3] SubName: Full=Uncharacterized protein {ECO:0000313|EMBL:EST09962.1};
MQSTDSMVDDPSIVIEERELIRFERADEYLSLLTSLVNPLDSTSTSSTPSFGPDETLSKL
LSILDEYQDQSHLLDPYLERIVSPPVEALQRHVRSSSSLPPAAVVRLSKLVYTYTKVRGY
KTILHYFPHEVADLPATLSFLEDLVAADDVRCWELRYVCLLWLSLICMIPFDLAKFDRPD
STSTTGERIAAVAEHFIASPGKERDAAAVVLGRLFQRNDRRNQFPAFLSKRLQAVKGEDA
SLFEATGVLQALCEVLKTSEPAFVLTHLADLETVIDAYDTHPNSALTNDGLITKYKTKLT
ARLALKLLRPRARRHANKYHVLGHPSAALPIEPEDEDESDISESTEPLISTLLTSLQHKD
TLVRYSAAKGLARLSDRLPTSFLTQVVDAILSLFAINVLEGDLSSVSEHTWQGGCLALAE
LSRRGLLFGDMLSEALPWVMQALMFDVRRGAHSVGSNVRDAACYVVWALARSNDVESIRP
HAVELARRLVCVATTDRDVSIRRAASAAFQESVGRLGLFPRGIEVIRLTDFYAVSVRRCA
VRECAVGVAAFEEYRGYLVDHLVEKVTVHWDPAMRRLGAQAVALIAMHDPRTLLPELAAR
VGKRVATSDNAVLHGTLLTLAELSRLSQTLSDDHALVGEEVRTTCFVLLDKVRPTMFRSL
GAAPLLEAACALIGAAIPAHTTSSANETQTWEKILNFALARPEETVHIAVADTIAHLSRC
VDISSKVRSTLQSWSTLTLPQQQSNALLLGAVDFGHDSRLLQDVVGHLMALTRPSTKTMA
TPMYSSNIEVRRNASDSLTRALVNLRDFAQMCTPDLLNRALQSLVGGLEDYATDQRGDVG
SWVRLSCIAGLRDVLKLCRRHARQIDRAQLDEAVGGMWKQAAERIDHVRCAAGTAVLCLY
RAYQGDEVRPQGYDVIEVAFGPLNTDESELEQIFKNPTKAFRAVTRLLLIPAYRSPILHG
LVLSVGSKSDLGERIIGPALADLTASTSYTLTALLSDIFDLAKKHFGNNRLFIPAMHTVN
LLLENGATHAGMDVPLARLLRMVLSNMGKVKSVPRLTAAATVSANVVLAIRPAGGKEELL
PLLIKATQAFLTHEFPTVRARCAEQLFAVLSSSVSFDDEEGEEKMEVWGELEMVLLDTKW
DSTTERFEEPVGVMTAALPRLLT

BLAST