GenomeNet

>tr:V6Q7W5_9ENTE [V6Q7W5] RecName: Full=V-type ATP synthase subunit I {ECO:0000256|RuleBase:RU361189};
MAVAKMKQVSLVVLKQDRAEMMAAIQAFQGVELRPLEENATIFETDRTQLAETTRKLQQL
HSAQMVIKPFKPKKTMSETRQGRSEFTMEELTALTRENKFEQVTDDILALDQKRSQLQGL
RKKNQEKQTELQPWLKLDVPLDEIPQLKQTQAEIGTVSSVIKSDFMQAVEKEKRPIYIEE
LSDIEGVTSYFLLYHQQDAETVDGLKYQYAFQTEALPKGGLPYETLQDLKKEERELVERE
KETMSRLKELAKEYQILDLAEEYFETLQIRHQESEKLSQTEATVVLTGWLIADEEEAFKS
FLSRKFPSGHYYLTIENITEEVAEEEIPVALTNNKLVEPFEMFTEMYSYPKYRQIDPTPF
LTPFQLVFFGMMLADVGYGALLWIGTFILNRFFNLDRGLARSIRFFHLLSYATIIWGIIY
GSAFGVELPFHVLSPTEDVIQILILSVVFGIIQILTGLAIGAYGSLRQNDMSGALSGSIS
WFLALTGVSLLALGKFALEMPVLVTVGLALIVIGVFLIVFMPVFTTKKSRIGGFFAGLWE
LYGATSYIGDIVSYTRLMALGLAGGSIASAFNTILAFLPTWAQFTIGIFLALAMHALNFF
LSTLSAYVHSMRLQYVEFFGKFYEGGGRKFAPFKAAEKHIYLKQEKTK

BLAST