KEGG   Acidovorax avenae: Acav_0153Help
Entry
Acav_0153         CDS       T01445                                 

Definition
(GenBank) arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
aaa  Acidovorax avenae
Pathway
aaa00220  Arginine biosynthesis
aaa00330  Arginine and proline metabolism
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01130  Biosynthesis of antibiotics
aaa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    Acav_0153
   00330 Arginine and proline metabolism
    Acav_0153
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     Acav_0153
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: ADX44079
JGI: Acav_0153
UniProt: F0Q174
Position
complement(166715..167674)
Genome map
AA seq 319 aa AA seqDB search
MDNVPFPRPVTLIGVPTDVGAARLGAAMGPDALRVAQLGPALERLGLEVQDQGNLHGPPN
PRGERTAEGLRNLAECEAWNRSTHDAVFAQLQAGRLPVMLGGDHNLAIGSVSAVARHCRE
TGKRLRVLWLDAHSDSNTPEISPSGNVHGVPVASLCGLGPPALAELGGPGPALRGAQMCQ
IGLRSVDAAEKRMIHELGLEVYDMRAIDELGMREVMHRALAGLEDDADAHLHLSFDVDFL
DPEIAPGTGTTVRGGPNYREAQLCMEMIADTGRLASLDIVELNPALDIRNQTAELVVDLV
ESLFGKSTLVRTPAPAGRR
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atggacaacgtcccctttccacgcccggtcacgctgatcggtgttcccacggatgtcggc
gccgcacgcctgggcgcggccatgggccccgacgcattgcgtgtcgcacagctcggcccg
gcgctcgaacggctgggcctggaggtgcaggaccagggtaacctgcacggcccaccgaat
ccgcgcggcgagcgcacggccgagggcctgcgcaacctcgccgaatgcgaggcctggaac
cggtccacccacgatgcggtgttcgcccagctgcaggccgggcgcctgccggtgatgctg
ggcggcgatcacaacctcgccatcggctcggtcagcgccgtggcgcgccactgccgggag
accggcaagcggctgcgcgtgctctggctggacgcgcattccgacagcaacacgccggag
atctcgcccagcggcaacgtgcacggcgtgccggtggccagcctctgcgggctgggcccg
cccgcgctcgcagagctcggtggccccgggccggcactgcgcggcgcgcagatgtgccag
atcgggctgcgcagcgtggatgcggccgagaagcgcatgatccacgagctcgggctggag
gtgtacgacatgcgcgcgatcgacgaactgggcatgcgcgaagtcatgcaccgtgcgctc
gcggggctggaggacgacgccgacgcgcacctgcacctgagcttcgacgtggattttctc
gatccggagatcgcccccggcacgggcaccacggtgcgcggcgggccgaactaccgcgag
gcccagctgtgcatggagatgatcgcggacacgggacgcctcgcctcgctcgacatcgtc
gaactcaaccccgcgctcgacatccgcaaccagaccgccgagctcgtggtggacctggtg
gaaagcctgttcggcaagagcacgctggtgcgcacgccggcccccgccgggcggcgctag

DBGET integrated database retrieval system