KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_0188Help
Entry
Acav_0188         CDS       T01445                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aaa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aaa00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:aaa00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(203251..204378)
Genome map
AA seq 375 aa AA seqDB search
MTTSLYIDPASGRTYPLDVPRWCSDDRKPLLITPQPGISRDDIDRTCRSQWRYRASLPLD
VARPISMGEGCTPLVQKEWGAHRPYFKLEWFHPTSSFKDRGTTVMLSVLRQQGVDAVLED
SSGNGGASVSAYGAAGGMRVKILAPAYASKPKIAQMRAYGAEVQLVEGPRQACEDEAVRQ
SEHIFYSSHNWQPFFLEGTKAIGYEIWEDLNFRAPDNIVMPAGAGSNVLGCFMAFSELLR
AGQIAKMPRLFVCQPLNCSPIDASFQAGVTTPVAREVRKTVAEGTAITHPLRLRELVSAV
QATGGVTVALQEQAIVGALKKVARTGLLPELTSATAIAGLDHLIQAGTVRESEETVVILT
ATGIKNADAIAEMFA
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacgacttcgctctacatcgacccggccagcggccggacctaccccctggacgtgccg
cggtggtgctccgacgaccgcaagccgctgctgatcacgccgcagcccggcatctcgcgc
gatgacatcgaccgcacgtgccgctcgcagtggcgctaccgggcatcgctgccgctggac
gtcgcgcgcccgatctccatgggcgagggctgcacgcccctcgtgcagaaggaatggggc
gcccaccggccgtacttcaagctggaatggttccacccgaccagcagcttcaaggaccgc
ggcaccacggtgatgctctccgtgctgcgccagcagggcgtcgatgcggtgctggaggac
agctcgggcaacggcggcgcgtcggtgtccgcgtacggcgccgcgggcggcatgcgcgtc
aagatcctcgcgccggcctatgcgtcgaaaccgaagatcgcgcagatgcgtgcctacggg
gcggaggtgcaactggtcgaggggccgcggcaggcctgcgaggacgaggcggtgcggcaa
tcggagcacatcttctattcgagccacaactggcagccgttcttcctcgagggcacgaag
gcgatcggctacgagatctgggaagacctgaacttccgcgcgccggacaacatcgtcatg
ccggccggcgccggcagcaatgtgctggggtgcttcatggcgttttccgagctgctgcgt
gcgggccagatcgcgaagatgccgcgcctgttcgtctgccagccgctgaactgctcaccg
atcgacgcgagcttccaggcgggcgtaacgacgccggtggcccgcgaggtgcgcaagacg
gtggccgagggcacggcgatcacgcaccccctgcggctgcgggagctcgtctcggcggtg
caggccaccggcggcgtcaccgtggcgctgcaggagcaggccatcgtcggcgcgctcaag
aaagtggcgcgcacgggcctgctgcccgaactcacgtctgccacggcgattgccggactc
gaccacctgatccaggccggtacggtccgcgagagcgaggagacggtggtgatcctgacg
gccaccggcatcaagaatgccgatgccatcgcggagatgttcgcatga

DBGET integrated database retrieval system