KEGG   Acidovorax avenae: Acav_0469Help
Entry
Acav_0469         CDS       T01445                                 

Definition
(RefSeq) malate synthase G (EC:2.3.3.9)
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
aaa  Acidovorax avenae
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Acav_0469
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Acav_0469
   00630 Glyoxylate and dicarboxylate metabolism
    Acav_0469
Enzymes [BR:aaa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Acav_0469
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(508392..510605)
Genome map
AA seq 737 aa AA seqDB search
MTDRTTVHGLQVATLLHQFIEARVLPGTGVDAAAFWSGFDAIVRDLAPRNIALLAERDRL
QSELDTWHKAHPGPVTDMAGYRAFLEKIGYLVPQPANVQATTANVDDELAVQAGPQLVVP
ILNARYALNAANARWGSLYDALYGTDAISEEGGAEKGKGYNPVRGAKVIAFAREVLDQAA
PLASGSHKDAAGYRVEGGQLAVQLQGGATTGLQDAAQFVGYQGDAAAPSSVLLRHNGLHL
DIQIDRSTPIGKTDPAGVSDLVLEAALSTILDLEDSVAAVDAEDKVAGYANWLGILQGTL
TESFAKGGQTVTRGLNADRIYTAPDGSGEVRLHGRSLMFLRNVGHLMTNPAVLWTDAQGT
QREIPEGILDAVVTTAIALHDLQGKGQNGIRNSRKGSVYIVKPKMHGPAEVAFASELFAR
VERLLGLPENTVKLGIMDEERRTSVNLKACIAAASARVAFINTGFLDRTGDEMHTAMQAG
PMVRKGDMKASAWIQAYEKSNVLVGLSCGLRGKAQIGKGMWAMPDLMKAMLEQKIAHPRA
GANTAWVPSPTGATLHALHYHQVNVADVQKELEKTSADAERDNLLTGLLTIPVAANPQWT
DAEKQQELDNNAQGILGYVVRWIDQGVGCSKVPDIHDVGLMEDRATLRISSQHIANWLLH
GVVTEAQVRATFERMAAVVDQQNAGDPAYRKMAGRFAESAAYQAACDLVFKGVEQPSGYT
EPLLHAWRLKVKAGAAR
NT seq 2214 nt NT seq  +upstreamnt  +downstreamnt
atgaccgaccgcaccaccgtccacggcctgcaagtggccacgctcctgcaccaattcatc
gaagcacgcgtgctgcccggcacgggcgtcgatgccgccgcgttctggtccggcttcgat
gccatcgtgcgggacctggctccgcgcaacatcgccctgctggccgagcgcgaccgcctg
cagtccgaactggacacctggcacaaggcccaccccggcccggtcaccgacatggcgggc
tatcgcgccttcctggagaagatcggctacctcgtgccgcaacccgcgaacgtgcaggcc
accaccgccaacgtggacgacgaactcgccgtccaggccggcccgcagctggtggtgccc
atcctgaacgcacgctacgccctcaacgccgccaacgcgcgctggggcagcctgtacgac
gcgctctacggcaccgacgccatctccgaagagggcggcgccgaaaagggcaagggctac
aacccggtgcgcggcgccaaggtgatcgccttcgcgcgtgaagtgctcgaccaggccgcg
ccgctggccagcggctcccacaaggacgccgcgggctaccgcgtggaaggcggccagctg
gccgtgcagttgcagggcggcgccaccaccggcctgcaggatgcggcccagttcgtgggc
taccagggcgatgccgcagcgccctcctcggtgctgctgcgccacaacggcctgcacctg
gacatccagatcgaccgcagcacgcccatcggcaagaccgacccggccggcgtgagcgac
ctggtgctcgaagccgcgctctccaccatcctggacctggaagactccgtcgccgccgtc
gatgcggaagacaaggtggccggctacgccaactggctgggcatcctgcagggcacgctg
accgaatccttcgccaagggcggccagaccgtcacccgcggcctgaacgccgaccgcatc
tacaccgcgcccgacggcagcggcgaagtgcgcctgcacggccgctcgctcatgttcctg
cgcaacgtgggccatctgatgaccaaccccgccgtgctgtggaccgacgcgcagggcacg
cagcgcgagatccccgaaggcatcctggacgccgtggtcaccaccgccatcgcgctgcac
gacctgcagggcaagggccagaacggcatccgcaattcgcgcaagggcagcgtctatatc
gtgaagcccaagatgcacggcccggccgaagtggcgttcgccagcgagctcttcgcccgc
gtggaacgcctgctgggcctgccggagaataccgtcaagctgggcatcatggacgaagag
cgccgcaccagcgtgaacctgaaggcctgcatcgccgccgcatcggcccgcgtggccttc
atcaacaccggcttcctggaccgcaccggcgacgagatgcacaccgccatgcaggccggc
cccatggtgcgcaagggcgacatgaaggccagcgcctggatccaggcctacgagaaaagc
aacgtgctggtgggcctgtcctgtggcctgcgcggcaaggcccagatcggcaagggcatg
tgggccatgcccgacctgatgaaggccatgctggagcagaagatcgcccaccccagggct
ggcgccaacaccgcctgggtgcccagccccacgggcgccacgctgcacgcactgcactac
caccaggtcaacgtggccgacgtgcagaaggaactggaaaagaccagtgccgatgccgag
cgcgacaacctgctcaccggcctgctgaccattcccgtcgccgcgaacccgcaatggacc
gacgccgagaaacagcaggaactggacaacaatgcccagggcatcctcgggtacgtggtg
cgctggatcgaccagggcgtgggctgctccaaggtgcccgacatccacgacgtgggcctg
atggaagaccgcgccacgctgcgcatcagcagccagcatatcgccaactggctgctgcac
ggcgtggtgaccgaggcccaggtgcgggccaccttcgagcgcatggccgccgtggtggac
cagcagaacgcgggtgatccggcctaccggaagatggccggccgcttcgccgagtccgcc
gcctaccaggccgcctgcgacctggtgttcaagggcgtggagcagcccagcggctacacc
gagccgctgctgcacgcctggcgcctcaaggtgaaggccggcgcggcgcgctga

DBGET integrated database retrieval system