KEGG   Acidovorax avenae: Acav_0573Help
Entry
Acav_0573         CDS       T01445                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
aaa  Acidovorax avenae
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Acav_0573
Enzymes [BR:aaa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Acav_0573
Exosome [BR:aaa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Acav_0573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(618782..620302)
Genome map
AA seq 506 aa AA seqDB search
MTYLLALDQGTSSSRSIVFDEHGHIVAQAQQELPQIYPQPGWVEHDPLEIWRTQLATARQ
ALAQAKIGPGDVRALGITNQRETTVLWNRRSGQPVHHAIVWQDRRAEPLCAELREQGHEP
MIQERTGLRIDAYFSATKLRWLLDHVPGARAAAEAGELAFGTVDSWLIWQLTGGKVHVTD
VSNASRTMLFNVHSNTWDDDLLALLRIPRELLPRVQPSASDFGATDAALLGGAIPIGGVA
GDQQSALFGQACFTAGMAKNTYGTGCFMLMHTGSSFQTSRNGLLTTSAAQIAPRGGPGQG
TPEPAFAMEGSVFVGGAVVQWLRDGLRAISTSSEVQSLAESVPDSGGVMMVPAFTGLGAP
YWKPDARGTITGLTRGTTIAHIARAALESIAYQSAALLQAMSRDAVAAGGAPVSELRVDG
GACVNDLLMQFQADLLGIPVVRPAVIETTALGAAYLAGLSSGVYAGTDALSALWRAERRF
LPTLSAARAQECMARWEHAVRQAALD
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgacctatctgctcgccctcgaccaaggcacctccagctcgcgcagcatcgttttcgac
gagcatgggcacatcgtcgcgcaggcccagcaggaactgccgcagatctatccgcagccc
ggctgggtggaacacgacccgctggagatctggcgcacgcagctggccacggcgcggcag
gcgctcgcgcaggcgaagatcggcccgggcgatgtgcgggcgctgggcatcaccaaccag
cgcgagaccacggtgctgtggaaccggcgctccgggcagcccgtgcaccatgccatcgtc
tggcaggaccggcgtgcggagccgctgtgcgccgaactgcgcgagcagggccacgagccg
atgatccaggagcgcacggggctgcgcatcgacgcatatttctcggcgaccaagctgcgc
tggctgctggaccatgtgcccggcgcgcgcgcggcggcagaggccggcgagctggccttc
ggcacggtggacagctggctcatctggcagctgacgggcggcaaggtgcacgtgaccgac
gtgagcaatgcctcgcgcaccatgctgttcaacgtgcattccaacacctgggacgacgac
ctgctggcgctgctgcgcattccacgcgaactgctgccgcgcgtgcagccttcggcgagc
gacttcggcgccacggacgcggcgctgctgggcggagccatcccgatcggcggggtggcc
ggcgaccagcagagcgcgctgttcggccaggcgtgtttcaccgcgggcatggccaagaac
acctacggcacgggctgcttcatgctgatgcacacgggcagcagcttccagacctcgcgc
aacgggctgctgacgaccagcgcggcgcagatcgccccccggggcgggccgggccagggc
acgccggagccagccttcgccatggagggcagcgtgttcgtcggcggcgcggtggtgcaa
tggctgcgcgacgggctgcgcgccatatcgaccagcagcgaggtgcagtcgctggccgag
agcgtgccggattccggcggcgtgatgatggtgccagccttcaccgggctgggcgcgccc
tactggaagcccgacgcccgcggcaccatcaccgggctcacccgcggcacgaccatcgcc
catatcgcgcgcgcggcgctcgagagcatcgcctaccagagcgcggcgctgctgcaggcg
atgagccgcgacgcggtggcggcaggcggcgcgcccgtgagcgagctgcgggtggacggc
ggagcctgcgtgaacgacctgctgatgcagttccaggccgacctgctgggcattccggtg
gtgcggccggcggtgatcgagaccacggcgctgggggccgcctatttggcgggactctcc
agcggggtctatgcgggcacggatgccctgtccgcgctgtggcgcgccgagcggaggttc
ctgcccacgctgagcgctgctcgcgcccaggaatgcatggcgcgctgggagcatgcggtg
cggcaggccgcgctggactga

DBGET integrated database retrieval system