KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_0834Help
Entry
Acav_0834         CDS       T01445                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(922963..923703)
Genome map
AA seq 246 aa AA seqDB search
MKLIPALLAGAAALTIGFGAHAQESAIRKTLGSRIPQLQNIDEVRATPMQGLYEVRIGTD
VFYTDAKGNYLIQGELIDTKARRNLTEDRINKLTAVDFASLPFQDAFTIVRGNGQRKLAV
FEDPNCGYCKRFEKDLQNVDNVTVYLFLYPILSPDSAEKSRNIWCSKDRAAAWQDHMVRD
KTTPAASCDTAAVQRNLAFGKKHKITGTPTLIFTDGSRVPGAIDAREVEKRLADAGSGAG
PAPATN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgatccccgccctgctcgccggcgccgccgcgctcaccatcggcttcggcgcc
cacgcccaggaatcggcgatccgcaagacgctgggcagccgcattccgcagctgcagaac
atcgacgaggtgcgcgccacgcccatgcagggcctgtacgaggtgcgcatcggcaccgat
gtgttctacaccgacgccaagggcaactacctcatccagggcgaactgatcgacaccaag
gcgcgccgcaacctcaccgaggaccgcatcaacaagctcacggcggtggatttcgcctcc
ctgcccttccaggacgcgttcaccatcgtgcgcggcaacggccagcgcaagctcgcggtg
ttcgaggacccgaactgcggctactgcaagcgcttcgagaaggacctgcagaacgtggac
aacgtgacggtctatctcttcctctatcccatcctgagccccgattcggccgagaagtcg
cgcaacatctggtgctccaaggaccgcgcggccgcgtggcaggaccacatggtgcgcgac
aagaccacgccggccgcgagctgcgacaccgccgccgtacagcgcaacctggccttcggc
aagaagcacaagatcaccggcacgccgacgctgatcttcaccgacggctcccgcgtgccg
ggcgcgatcgacgcgcgcgaggtggaaaagcgcctcgccgacgcaggatcgggcgccggc
ccggcccccgccacgaactga

DBGET integrated database retrieval system