KEGG   Acidovorax avenae: Acav_0859Help
Entry
Acav_0859         CDS       T01445                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
aaa  Acidovorax avenae
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Acav_0859
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acav_0859
Enzymes [BR:aaa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Acav_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
953589..954551
Genome map
AA seq 320 aa AA seqDB search
MLSKRNPQLNRNGELIHLLSIEGLPRSIVTHILDTAANFVSVNDREVKKVPLLRGKSVFN
LFFENSTRTRTTFEIAAKRLSADVLNLDIARSSASKGESLLDTIANLSAMAADLFVVRHS
ESGAPYLIAQHVAPHVHVINAGDGRHAHPTQGLLDMYTIRHYKKDFSNLTVAIVGDVLHS
RVARSDIHGLTTLGCPEVRVVGPRTLVPGDLSQMGVRVCHTLEEGIRDADVVIMLRLQNE
RMSGALLPSSQEYFKSFGLTPEKLRLAKPDAIVMHPGPINRGVEIDSAVVDGPQAVILPQ
VTFGIAVRMAVMSIVAGNEA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgctctccaagcgcaacccccagctcaaccgcaacggcgagttgatccacttgctgtcc
atcgagggcctgccccgcagcatcgtcacgcacatcctcgataccgcggcgaacttcgtg
tcggtgaacgaccgcgaggtgaagaaggtgccgctgctgcgcggcaagagcgtgttcaac
ctgttcttcgagaacagcacgcgcacccgcacgaccttcgagatcgcggccaagcgcctg
tcggccgacgtgctcaacctcgacatcgcgcgctcgtccgccagcaagggcgaatcgctg
ctggacaccatcgccaacctctcggccatggcggcagacctgttcgtggtgcggcacagc
gaatcgggcgcgccctacctgatcgcgcagcacgtggcgccgcacgtacacgtgatcaac
gcgggcgacggccggcatgcgcaccccacgcaggggctgctcgacatgtacaccatccgc
cactataagaaggatttctccaacctcacggtggcgatcgtgggcgacgtgctgcactcg
cgcgtggcccgctcggacatccacggcctcaccaccctgggctgcccggaggtgcgcgtg
gtgggcccgcgcaccctggtgcccggagacctctcccagatgggcgtgcgcgtgtgccac
acgctggaagagggcatcagggacgccgacgtggtcatcatgctgcgcctgcagaacgag
cgcatgagcggcgcgctgctgccctccagccaggaatacttcaagagcttcggcctcacg
cccgagaagctgcgcctggccaagcccgatgccatcgtcatgcaccccgggccgatcaac
cgcggggtggagatcgactccgccgtggtcgatgggccgcaggcggtgatcctgccccag
gtcaccttcggcatcgccgtgcgcatggccgtgatgtccatcgtcgcggggaatgaggct
taa

DBGET integrated database retrieval system