KEGG   Acidovorax avenae: Acav_1002Help
Entry
Acav_1002         CDS       T01445                                 

Definition
histidinol-phosphate aminotransferase (EC:2.6.1.9)
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
aaa  Acidovorax avenae
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acav_1002
  Amino acid metabolism
   00340 Histidine metabolism
    Acav_1002
   00350 Tyrosine metabolism
    Acav_1002
   00360 Phenylalanine metabolism
    Acav_1002
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acav_1002
  Biosynthesis of other secondary metabolites
   00401 Novobiocin biosynthesis
    Acav_1002
Enzymes [BR:aaa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.9  histidinol-phosphate transaminase
     Acav_1002
Amino acid related enzymes [BR:aaa01007]
 Aminotransferase (transaminase)
  Class II
   Acav_1002
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1120550..1121662
Genome map
AA seq 370 aa AA seqDB search
MTDTLAAALGRIRPDVRAMHAYAVQPATGVLKMDAMENPFPLPPELQEALGRRLGTLALN
RYPGARLADLKQALAAHIGMPEGFSMVLGNGSDEIITLLALACARPGTGERATMLAPMPG
FVMYPMSAQLQGLDFVGVPLTADFELDEPAMLAAIARHRPAITYLAYPNNPTATLWDEGA
VQRVIDAVGAQGGIVVMDEAYQPFASRTWLDRMRAEPARNAHVLLMRTLSKFGLAGVRLG
YLAGPAALVDEIEKVRPPYNVSVLNCEAALFALEHAPVFAAQAAELRAARTGLVAALRAM
PGIERVWDSEANMVLVRVPDAARAFEGMKARKVLVKNVSTMHPLLARCLRLTVGSEADNA
RMLDALQASL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacccttgccgccgcgctcggccgcatccgccccgacgtccgcgccatgcat
gcctacgcggtgcagcccgccaccggcgtgctcaagatggacgcgatggaaaaccccttc
ccgctgccgccggagctgcaggaggcgctgggccggcgcctgggcaccctggcactgaac
cgctaccccggcgcgcgtctggccgatctgaagcaggcgctcgccgcgcacatcggcatg
ccggagggcttctcgatggtgctgggcaatggctccgacgagatcatcacgctgctggcg
ctggcctgcgcgcggcccggcacgggcgagcgcgcgaccatgctcgcgcccatgccgggg
ttcgtgatgtacccgatgagcgcgcagttgcagggcctggatttcgtgggcgtgccgctc
acggccgatttcgagctggatgaaccggccatgctcgccgccatcgcccggcaccgcccg
gccatcacctacctggcttacccgaacaaccccacggccacgctgtgggacgagggggcg
gtgcagcgcgtcatcgacgcggtgggcgcgcagggcggcatcgtggtcatggacgaggcg
taccagcctttcgcgagccgcacctggctggaccgcatgcgcgccgagcccgcccgcaac
gcccacgtgctgctcatgcgcacgctcagcaagttcggcctggcgggcgtgcgcctgggc
tacctggccgggccggcggcgctggtggacgagatcgagaaggtgcgccccccctacaac
gtgagcgtgctcaactgcgaggcggcgctcttcgcgctggagcatgcgccggtgttcgcc
gcgcaggcggccgagctgcgcgccgcgcgcaccgggctggtcgccgcgctgcgcgccatg
ccgggcatcgagcgcgtgtgggacagcgaggccaacatggtgctcgtgcgcgtgcccgac
gcggcacgggccttcgagggcatgaaagcccgcaaggttctcgtcaagaacgtttctaca
atgcatcccttgctggcccgctgcctgcgcctcacggtgggcagcgaggccgacaatgcc
cggatgctcgacgcactccaggcttccctatga

DBGET integrated database retrieval system