KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_1002Help
Entry
Acav_1002         CDS       T01445                                 

Definition
histidinol-phosphate aminotransferase (EC:2.6.1.9)
Orthology
K00817  
histidinol-phosphate aminotransferase [EC:2.6.1.9]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Histidine metabolism
Tyrosine metabolism
Phenylalanine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Novobiocin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aaa01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:aaa00340]
Metabolism; Amino acid metabolism; Tyrosine metabolism [PATH:aaa00350]
Metabolism; Amino acid metabolism; Phenylalanine metabolism [PATH:aaa00360]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aaa00400]
Metabolism; Biosynthesis of other secondary metabolites; Novobiocin biosynthesis [PATH:aaa00401]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1120550..1121662
Genome map
AA seq 370 aa AA seqDB search
MTDTLAAALGRIRPDVRAMHAYAVQPATGVLKMDAMENPFPLPPELQEALGRRLGTLALN
RYPGARLADLKQALAAHIGMPEGFSMVLGNGSDEIITLLALACARPGTGERATMLAPMPG
FVMYPMSAQLQGLDFVGVPLTADFELDEPAMLAAIARHRPAITYLAYPNNPTATLWDEGA
VQRVIDAVGAQGGIVVMDEAYQPFASRTWLDRMRAEPARNAHVLLMRTLSKFGLAGVRLG
YLAGPAALVDEIEKVRPPYNVSVLNCEAALFALEHAPVFAAQAAELRAARTGLVAALRAM
PGIERVWDSEANMVLVRVPDAARAFEGMKARKVLVKNVSTMHPLLARCLRLTVGSEADNA
RMLDALQASL
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacacccttgccgccgcgctcggccgcatccgccccgacgtccgcgccatgcat
gcctacgcggtgcagcccgccaccggcgtgctcaagatggacgcgatggaaaaccccttc
ccgctgccgccggagctgcaggaggcgctgggccggcgcctgggcaccctggcactgaac
cgctaccccggcgcgcgtctggccgatctgaagcaggcgctcgccgcgcacatcggcatg
ccggagggcttctcgatggtgctgggcaatggctccgacgagatcatcacgctgctggcg
ctggcctgcgcgcggcccggcacgggcgagcgcgcgaccatgctcgcgcccatgccgggg
ttcgtgatgtacccgatgagcgcgcagttgcagggcctggatttcgtgggcgtgccgctc
acggccgatttcgagctggatgaaccggccatgctcgccgccatcgcccggcaccgcccg
gccatcacctacctggcttacccgaacaaccccacggccacgctgtgggacgagggggcg
gtgcagcgcgtcatcgacgcggtgggcgcgcagggcggcatcgtggtcatggacgaggcg
taccagcctttcgcgagccgcacctggctggaccgcatgcgcgccgagcccgcccgcaac
gcccacgtgctgctcatgcgcacgctcagcaagttcggcctggcgggcgtgcgcctgggc
tacctggccgggccggcggcgctggtggacgagatcgagaaggtgcgccccccctacaac
gtgagcgtgctcaactgcgaggcggcgctcttcgcgctggagcatgcgccggtgttcgcc
gcgcaggcggccgagctgcgcgccgcgcgcaccgggctggtcgccgcgctgcgcgccatg
ccgggcatcgagcgcgtgtgggacagcgaggccaacatggtgctcgtgcgcgtgcccgac
gcggcacgggccttcgagggcatgaaagcccgcaaggttctcgtcaagaacgtttctaca
atgcatcccttgctggcccgctgcctgcgcctcacggtgggcagcgaggccgacaatgcc
cggatgctcgacgcactccaggcttccctatga

DBGET integrated database retrieval system