KEGG   Acidovorax avenae: Acav_1017Help
Entry
Acav_1017         CDS       T01445                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
aaa  Acidovorax avenae
Pathway
aaa00010  Glycolysis / Gluconeogenesis
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01120  Microbial metabolism in diverse environments
aaa01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Acav_1017
Enzymes [BR:aaa01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Acav_1017
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: ADX44939
JGI: Acav_1017
UniProt: F0QB77
Position
1142081..1142944
Genome map
AA seq 287 aa AA seqDB search
MTATAPAVPAASLPPFPDLPAVRLHNPRSGAATVAFQGAQVLSWTTADGVERLFLSPRSA
HDGHTAIRGGVPVCCPQFNQRGALPKHGFMRNLPWKLVSESSNGHVTGAVMALGDDEATR
AIWPHAFQALLSVELSGDALRVSLTLRNTGDVPWSFTGALHTYLRVADIARAQVDGLQGC
ARWDAVADRRGVQEGAVRFDGEYDSVFDAPGAPLRVDTGQGVLAATQGGWTENVVWNPGA
GRCAALPDMPADGFRHMLCVEAACVHRPVEVAPGAEWTGWQRFEVLR
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atgacagccaccgctccggccgtgcccgcggcctccctcccgccatttccggacctgccc
gccgtccgcctgcacaacccccggtcgggcgccgccaccgtggctttccaaggggcgcag
gtgctttcctggaccaccgcggacggcgtcgagcgccttttcctgagcccccggtcggcc
catgacggacacacggcgatccgcggcggggtgccggtctgctgcccccaattcaaccag
cgcggggctttgcccaagcatggcttcatgcgaaatttgccttggaaattggtatccgag
tcgtcaaacggtcacgtgacgggtgccgtgatggcgctcggggacgacgaggccacccgc
gcgatctggccccatgccttccaggcgctgctgagcgtcgaattgtccggggatgcgctg
cgcgtgtcgctgacactgcgcaacaccggcgatgtgccctggtccttcaccggggcgctg
catacctacctgcgggtggcggacatcgcccgggcgcaggtggacggcctgcagggctgc
gcccgctgggacgccgtggccgaccggcgcggcgtgcaggagggcgcggtgcgcttcgac
ggcgaatacgacagcgtgttcgatgccccgggcgcgccgctgcgcgtggacacggggcag
ggcgtgctggccgccacccagggcggctggaccgagaatgtggtctggaatcccggggcc
gggcgctgcgcggcgctgccggacatgcccgcagacggcttccgccacatgctctgcgtc
gaggcggcctgcgtgcaccggcccgtcgaagtcgcgccgggcgccgaatggaccggctgg
caacggttcgaagtgctgcgctga

DBGET integrated database retrieval system