KEGG   Acidovorax avenae: Acav_1215Help
Entry
Acav_1215         CDS       T01445                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aaa  Acidovorax avenae
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Acav_1215
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Acav_1215
Enzymes [BR:aaa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Acav_1215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1356684..1357823
Genome map
AA seq 379 aa AA seqDB search
MTADIEHAPVILDIAGTALTPADRRRLAHPLTGGIILFARNWESRAQLLELTASIKAVRD
DLLICVDHEGGRVQRFRTDGFTHLPPMRALGALWMDDGRQGPGTGAMRAMDAASATGYVL
ASELRACGVDFSFAPVLDLDWPSGGKGPSGSASASSVIGDRSFHRDPRVVAMLARSVAHG
MLKAGMAHCGKHFPGHGFVAADSHTDIPVDRRPLGAILADDAAPYAWLSNTLTSVMPAHV
IYPRVDRLPAGFSRRWLQDVLRQRLRFSGAVFSDDLSMEGARRIDGDAVDFATATLAALD
AGCDLVLLCNQSLVGEGREQGRALDDVLDALELARGEGRWRPSPDSEARRLALLPQTLPH
PWDELMLEPDYLRALDCLP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgacatcgaacacgcacccgtcatcctcgacatcgccggcacggcgctcact
ccggccgaccgcaggcgcctggcccatccgctcaccggggggatcatcctcttcgcccgg
aactgggaaagccgggcgcagctgctggagctcacggcctcgatcaaggccgtgcgggac
gacctgctcatctgcgtggaccacgaggggggccgggtgcagcgctttcgcaccgacggg
ttcacccacctgccccccatgcgggccctgggcgccctgtggatggacgacggtcgccag
gggccgggcaccggcgcgatgcgcgcgatggatgccgccagcgcgaccggctacgtgctg
gccagcgagctgcgcgcctgcggcgtggatttctcgttcgcaccggtgctggacctggac
tggccgtcgggtgggaaagggccttcgggcagtgcctcggcaagcagcgtgatcggtgac
cggtccttccaccgagacccgcgcgtggtggcgatgctggccagaagcgtggcgcacggc
atgctcaaggcgggcatggcgcactgcggcaagcatttccccggacacggcttcgtcgcg
gccgattcgcataccgacatccccgtggaccggcgccctctgggcgcgatcctggcggat
gacgccgcgccgtatgcctggctgtcgaacacgctgaccagcgtgatgccggcgcatgtc
atctatccgcgtgtggaccggcttccggcaggtttctcgcgccgctggctgcaggacgtc
ctgcgccagcgcctgcggttcagcggagcggtgttcagcgacgatctcagcatggaaggc
gcccgccgcatcgatggcgatgcggtggacttcgcgaccgccacgctcgcagccctcgat
gccggctgcgacctcgtgctgctgtgcaatcagagcctggtaggcgaggggcgtgagcag
ggcagggcgctcgacgatgtgctcgatgccctggagctcgcacgcggcgaagggcgctgg
cgccccagcccggacagcgaggcccgccggctcgccctgcttccacagacgctgccccat
ccgtgggacgagctcatgctggaaccggactacctgagggcgctggattgcctgccctga

DBGET integrated database retrieval system