KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_1215Help
Entry
Acav_1215         CDS       T01445                                 

Definition
glycoside hydrolase family protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:aaa00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:aaa00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1356684..1357823
Genome map
AA seq 379 aa AA seqDB search
MTADIEHAPVILDIAGTALTPADRRRLAHPLTGGIILFARNWESRAQLLELTASIKAVRD
DLLICVDHEGGRVQRFRTDGFTHLPPMRALGALWMDDGRQGPGTGAMRAMDAASATGYVL
ASELRACGVDFSFAPVLDLDWPSGGKGPSGSASASSVIGDRSFHRDPRVVAMLARSVAHG
MLKAGMAHCGKHFPGHGFVAADSHTDIPVDRRPLGAILADDAAPYAWLSNTLTSVMPAHV
IYPRVDRLPAGFSRRWLQDVLRQRLRFSGAVFSDDLSMEGARRIDGDAVDFATATLAALD
AGCDLVLLCNQSLVGEGREQGRALDDVLDALELARGEGRWRPSPDSEARRLALLPQTLPH
PWDELMLEPDYLRALDCLP
NT seq 1140 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccgacatcgaacacgcacccgtcatcctcgacatcgccggcacggcgctcact
ccggccgaccgcaggcgcctggcccatccgctcaccggggggatcatcctcttcgcccgg
aactgggaaagccgggcgcagctgctggagctcacggcctcgatcaaggccgtgcgggac
gacctgctcatctgcgtggaccacgaggggggccgggtgcagcgctttcgcaccgacggg
ttcacccacctgccccccatgcgggccctgggcgccctgtggatggacgacggtcgccag
gggccgggcaccggcgcgatgcgcgcgatggatgccgccagcgcgaccggctacgtgctg
gccagcgagctgcgcgcctgcggcgtggatttctcgttcgcaccggtgctggacctggac
tggccgtcgggtgggaaagggccttcgggcagtgcctcggcaagcagcgtgatcggtgac
cggtccttccaccgagacccgcgcgtggtggcgatgctggccagaagcgtggcgcacggc
atgctcaaggcgggcatggcgcactgcggcaagcatttccccggacacggcttcgtcgcg
gccgattcgcataccgacatccccgtggaccggcgccctctgggcgcgatcctggcggat
gacgccgcgccgtatgcctggctgtcgaacacgctgaccagcgtgatgccggcgcatgtc
atctatccgcgtgtggaccggcttccggcaggtttctcgcgccgctggctgcaggacgtc
ctgcgccagcgcctgcggttcagcggagcggtgttcagcgacgatctcagcatggaaggc
gcccgccgcatcgatggcgatgcggtggacttcgcgaccgccacgctcgcagccctcgat
gccggctgcgacctcgtgctgctgtgcaatcagagcctggtaggcgaggggcgtgagcag
ggcagggcgctcgacgatgtgctcgatgccctggagctcgcacgcggcgaagggcgctgg
cgccccagcccggacagcgaggcccgccggctcgccctgcttccacagacgctgccccat
ccgtgggacgagctcatgctggaaccggactacctgagggcgctggattgcctgccctga

DBGET integrated database retrieval system