KEGG   Acidovorax avenae: Acav_1229Help
Entry
Acav_1229         CDS       T01445                                 

Definition
(GenBank) tryptophan synthase, alpha subunit (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
aaa  Acidovorax avenae
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Acav_1229
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acav_1229
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acav_1229
Enzymes [BR:aaa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acav_1229
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1372426..1373286)
Genome map
AA seq 286 aa AA seqDB search
MSTDMTTSAPPAATAPAQGRIGATFADLQARGRKALIPYVTAGFPFADITPALMHGMVEA
GADVIELGVPFSDPMADGPVIQKAGEKALSLGVGMAQVLGYVREFRQRNTKTPVVLMGYA
NPVERYDQRHGEDAFVRDAAQAGVDGVLIVDYPPEECEDFAARLRAQGMDLIFLLAPTST
EQRMQQVARVASGYVYYVSLKGVTGSGALDTSAVEAMLPVIRRHVHIPVGVGFGIRDAAT
AQAIGRVADAVVIGSRIIQLLDDQPHERVVPLAVDFLRGVRKALDT
NT seq 861 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacatgacgacttccgcgcccccggcagcgacggcgcccgcccagggccgc
atcggggcgacgttcgccgacctgcaggcccgcggccgcaaggccctcattccctacgtg
accgccggcttcccgttcgcggacatcacgcctgcgctgatgcacggcatggtcgaggcc
ggcgccgacgtgatcgaactcggcgttccattctccgaccccatggccgacggcccggtg
atccagaaggccggggaaaaggccctctccctgggcgtgggcatggcccaggtgctcggc
tatgtgcgcgagttccgccagcgcaacacgaagaccccggtggtgctcatgggctatgcc
aacccggtggagcgctacgaccagcgccacggcgaggacgcctttgtgcgcgacgcggcc
caggccggcgtggacggggtgctgatcgtggactacccccccgaggaatgcgaggacttc
gccgcccggctgcgcgcacagggcatggacctgatcttcctgctggcgcccaccagcacg
gagcagcgcatgcagcaggtggcgcgcgtcgcgagcggctacgtgtactacgtctcgctc
aagggcgtgaccggatcgggcgccctcgacacctcggccgtggaagcgatgctgccggtg
atccgccgccatgtgcacatccccgtcggcgtgggtttcggcatccgcgatgcggccacc
gcgcaagccatcggccgcgtcgcggatgccgtggtgatcggcagccgcatcatccaactg
ctggacgaccagccccacgaacgggtcgtgcccctggccgtggacttcctgcggggggtg
cgcaaggcgctcgacacgtag

DBGET integrated database retrieval system