KEGG   Acidovorax avenae subsp. avenae ATCC 19860: Acav_1230Help
Entry
Acav_1230         CDS       T01445                                 

Definition
tryptophan synthase subunit beta (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aaa  Acidovorax avenae subsp. avenae ATCC 19860
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:aaa01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:aaa00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:aaa00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1373283..1374551)
Genome map
AA seq 422 aa AA seqDB search
MLSYQQPDASGHFGRYGGSFASETLTHALTELREAYARYQNDPEFLKEFHSELAHFVGRP
SPIYHAARMSREMGGAQIFLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQH
GVATATICARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSRTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGTECLAQMPGMLEEQRIAAEHPDAVIA
CVGGGSNAMGIFHPYIPHEKTRLIGVEAAGEGLDSGKHSASLQRGSAGVLHGNRTFILQD
ENGQITETHSISAGLDYPGVGPEHAWLQEIGRAEYVGITDKEALDAFHYLCRTEGIIPAL
ESSHAVAYAMQLAKTLRADQSILVNLSGRGDKDIGTVADLSGVDFYDRPSMRGHAVKGGP
AA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctttcctaccaacagcccgacgcttcgggccacttcggccgctatggcggcagtttc
gcgagcgagacgctcacgcatgccctcaccgagctgcgcgaggcgtatgcgcgctaccag
aacgacccggagttcctgaaggaattccacagcgaactcgcgcacttcgtgggccggccc
tcgcccatctaccatgccgcccgcatgagccgcgaaatgggtggcgcgcagatcttcctc
aagcgggaagacctcaaccacacgggcgcgcacaagatcaacaacgtgatcggccaggcc
atgctcgcccgccgcatgggcaagccgcgcgtgatcgccgagaccggcgcgggccagcac
ggcgtggccaccgccaccatctgcgcgcgctacggcctcgaatgcgtggtgtacatgggc
gcggaagacgtgaagcgccagagcccgaacgtctatcgcatgaagctgctgggcgccacc
gtggtgcccgtggagtcgggcagccgcacgctcaaggacgcgctcaacgaggccatgcgc
gactgggtcgcgaacgtggacaacaccttctacatcatcggcacggtggcgggcccgcac
ccctatcccatgatggtgcgcgacttccagagcgtgatcggcaccgaatgcctcgcgcag
atgcccggcatgctggaggagcagcgcatcgccgccgagcacccggacgcggtgatcgcc
tgtgtgggcggcggcagcaatgccatgggcatcttccatccctacatcccgcacgagaag
acgcgcctcatcggcgtggaagccgccggcgaggggctggacagcggcaagcattcggca
tcgctgcagcgcggcagcgcgggcgtgctgcacggcaaccgcaccttcatcctgcaggac
gagaacggccagatcacggagacccacagcatcagcgccggcctggactaccccggcgtc
gggcccgagcatgcctggctgcaggagatcggccgcgccgagtacgtgggcatcaccgac
aaggaagcgctcgacgccttccactacctctgccgcaccgagggcatcatcccggcgctg
gagtccagccatgccgtggcctatgcgatgcagctcgccaagaccctgcgcgccgaccag
tccatcctcgtgaacctgtcaggccgcggggacaaggacatcggcacggtggcggatctc
tcgggcgtggacttctacgaccgcccgtccatgcggggccatgccgtcaagggaggaccc
gcagcatga

DBGET integrated database retrieval system