KEGG   Acidovorax avenae: Acav_1230Help
Entry
Acav_1230         CDS       T01445                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
aaa  Acidovorax avenae
Pathway
aaa00260  Glycine, serine and threonine metabolism
aaa00400  Phenylalanine, tyrosine and tryptophan biosynthesis
aaa01100  Metabolic pathways
aaa01110  Biosynthesis of secondary metabolites
aaa01130  Biosynthesis of antibiotics
aaa01230  Biosynthesis of amino acids
Module
aaa_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Acav_1230
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Acav_1230
Enzymes [BR:aaa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Acav_1230
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADX45152
JGI: Acav_1230
UniProt: F0Q0C7
Position
complement(1373283..1374551)
Genome map
AA seq 422 aa AA seqDB search
MLSYQQPDASGHFGRYGGSFASETLTHALTELREAYARYQNDPEFLKEFHSELAHFVGRP
SPIYHAARMSREMGGAQIFLKREDLNHTGAHKINNVIGQAMLARRMGKPRVIAETGAGQH
GVATATICARYGLECVVYMGAEDVKRQSPNVYRMKLLGATVVPVESGSRTLKDALNEAMR
DWVANVDNTFYIIGTVAGPHPYPMMVRDFQSVIGTECLAQMPGMLEEQRIAAEHPDAVIA
CVGGGSNAMGIFHPYIPHEKTRLIGVEAAGEGLDSGKHSASLQRGSAGVLHGNRTFILQD
ENGQITETHSISAGLDYPGVGPEHAWLQEIGRAEYVGITDKEALDAFHYLCRTEGIIPAL
ESSHAVAYAMQLAKTLRADQSILVNLSGRGDKDIGTVADLSGVDFYDRPSMRGHAVKGGP
AA
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgctttcctaccaacagcccgacgcttcgggccacttcggccgctatggcggcagtttc
gcgagcgagacgctcacgcatgccctcaccgagctgcgcgaggcgtatgcgcgctaccag
aacgacccggagttcctgaaggaattccacagcgaactcgcgcacttcgtgggccggccc
tcgcccatctaccatgccgcccgcatgagccgcgaaatgggtggcgcgcagatcttcctc
aagcgggaagacctcaaccacacgggcgcgcacaagatcaacaacgtgatcggccaggcc
atgctcgcccgccgcatgggcaagccgcgcgtgatcgccgagaccggcgcgggccagcac
ggcgtggccaccgccaccatctgcgcgcgctacggcctcgaatgcgtggtgtacatgggc
gcggaagacgtgaagcgccagagcccgaacgtctatcgcatgaagctgctgggcgccacc
gtggtgcccgtggagtcgggcagccgcacgctcaaggacgcgctcaacgaggccatgcgc
gactgggtcgcgaacgtggacaacaccttctacatcatcggcacggtggcgggcccgcac
ccctatcccatgatggtgcgcgacttccagagcgtgatcggcaccgaatgcctcgcgcag
atgcccggcatgctggaggagcagcgcatcgccgccgagcacccggacgcggtgatcgcc
tgtgtgggcggcggcagcaatgccatgggcatcttccatccctacatcccgcacgagaag
acgcgcctcatcggcgtggaagccgccggcgaggggctggacagcggcaagcattcggca
tcgctgcagcgcggcagcgcgggcgtgctgcacggcaaccgcaccttcatcctgcaggac
gagaacggccagatcacggagacccacagcatcagcgccggcctggactaccccggcgtc
gggcccgagcatgcctggctgcaggagatcggccgcgccgagtacgtgggcatcaccgac
aaggaagcgctcgacgccttccactacctctgccgcaccgagggcatcatcccggcgctg
gagtccagccatgccgtggcctatgcgatgcagctcgccaagaccctgcgcgccgaccag
tccatcctcgtgaacctgtcaggccgcggggacaaggacatcggcacggtggcggatctc
tcgggcgtggacttctacgaccgcccgtccatgcggggccatgccgtcaagggaggaccc
gcagcatga

DBGET integrated database retrieval system