KEGG   Acidovorax avenae: Acav_1255Help
Entry
Acav_1255         CDS       T01445                                 

Definition
aspartate transaminase (EC:2.6.1.1)
Orthology
K14260  
alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
aaa  Acidovorax avenae
Pathway
Alanine, aspartate and glutamate metabolism
Valine, leucine and isoleucine biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:aaa00001]
 Metabolism
  Overview
   01210 2-Oxocarboxylic acid metabolism
    Acav_1255
   01230 Biosynthesis of amino acids
    Acav_1255
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Acav_1255
   00290 Valine, leucine and isoleucine biosynthesis
    Acav_1255
Enzymes [BR:aaa01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     Acav_1255
    2.6.1.66  valine---pyruvate transaminase
     Acav_1255
Amino acid related enzymes [BR:aaa01007]
 Aminotransferase (transaminase)
  Class I
   Acav_1255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1398181..1399410
Genome map
AA seq 409 aa AA seqDB search
MKTIHKSAKLNNVLYDVRGPIVDAAKQMEDEGQKIIKLNIGNLAPFGFDAPEEIQQDMIR
NLPNSAGYSDSKGIFAARKAVMHYSQQQGVKGVTLDDIYLGNGASDLITMATNALLDDGD
ELLVPAPDYPLWTAAASLSGGRPVHYLCDEANGWMPNLDDIRAKITPRTKGLVVINPNNP
TGALYSDELLRGLVQIARDHGLVLLADEVYDKVLYDGERHTAMASLSTDVLTLTFNSLSK
AYRSCGYRAGWMVVSGNKAVARDYIEGINMLANIKLGSNVPGQWAIQTALGGYQSINDLV
REGGRLCRQRDLAYELISAIPGVSCVKPKAALYMFPRLDPAMYPIADDRQFFMEVLRATR
VMLVQGSGFNYPDQQHFRIVFLPHEDDLREAIGRLADFLALYRQKHAAA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgatccacaagtccgcgaagctgaataacgttctctacgatgtgcggggcccg
atcgtggatgcggccaagcagatggaggacgagggccagaagatcatcaagctcaacatc
ggcaacctcgcgccgttcggcttcgatgcacccgaagagatccagcaggacatgatccgc
aacctgccgaactcggcaggctattcggacagcaagggcatcttcgcggcgcgcaaggcc
gtgatgcactacagccagcagcagggcgtgaagggcgtgacgctcgacgacatctacctg
ggcaatggcgcgagcgacctgatcaccatggccacgaatgcgctgctcgacgatggcgac
gagctgctggtgccggcgcccgactacccgctctggaccgcggcggccagtctgtccggc
ggccggccggtgcactacctgtgcgacgaggcgaacggctggatgccgaacctcgacgac
atccgcgccaagatcacgccccgcaccaagggcctcgtggtgatcaacccgaacaacccc
acgggcgcgctctattccgacgagctgctgcgcgggctcgtgcagatcgcgcgcgaccat
ggcctcgtgctgctggccgacgaggtgtacgacaaggtgctctacgacggcgagcgccac
acggccatggccagcctctcgaccgacgtgctcacgctcaccttcaattcgctctcgaag
gcctaccgctcgtgcggctaccgcgccggctggatggtggtgtcgggcaacaaggccgtg
gcccgcgactacatcgagggcatcaacatgctcgccaacatcaagctgggctccaacgtg
cccgggcagtgggcgatccagaccgcgctgggcggctaccagagcatcaatgacctggtc
cgggaaggcgggcgcctctgccggcagcgcgacctggcctacgaactcatctcggcgatc
ccgggcgtgagctgcgtgaagcccaaggcggcgctgtacatgttcccgcgcctcgacccg
gccatgtaccctatcgccgacgaccgccagttcttcatggaagtgctgcgcgccacgcgc
gtgatgctggtgcagggatcgggcttcaactatcccgaccagcagcatttccgcatcgtg
ttcctcccgcacgaggacgacctgcgcgaggcgatcggccgcctggcggacttcctggcg
ctctaccgccagaagcacgcggccgcgtga

DBGET integrated database retrieval system